(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE214

CP001994.PE214       Location/Qualifiers
FT   CDS             complement(246933..247223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4033 conserved hypothetical protein;
FT                   InterPro IPR012031; PFAM: conserved hypothetical protein;
FT                   SPTR: Q12UL9 Putative uncharacterized protein; PFAM: Domain
FT                   of unknown function (DUF1894)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35752"
FT                   /db_xref="InterPro:IPR012031"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A1"
FT                   /protein_id="ADE35752.1"
FT                   /translation="MINMACISDLPYEILLKGASVKKSEEFIRENCDEVYHVPGGYSLA
FT                   GVMLKGGKTIPIGVKGNSIYFQYVKPCKGLFVLKLDDAQDEIEKLRQGNYQ"
     MINMACISDL PYEILLKGAS VKKSEEFIRE NCDEVYHVPG GYSLAGVMLK GGKTIPIGVK        60
     GNSIYFQYVK PCKGLFVLKL DDAQDEIEKL RQGNYQ                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page