(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE215

CP001994.PE215       Location/Qualifiers
FT   CDS             complement(247220..248218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0220"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="COGs: COG0150 Phosphoribosylaminoimidazole (AIR)
FT                   synthetase; InterPro IPR010918:IPR000728:IPR004733; KEGG:
FT                   phosphoribosylformylglycinamidine cyclo-ligase
FT                   (phosphoribosyl-aminoimidazole synthetase) (AIR synthase);
FT                   K01933 phosphoribosylformylglycinamidine cyclo-ligase;
FT                   PFAM: AIR synthase related protein domain protein; AIR
FT                   synthase related protein; PRIAM:
FT                   Phosphoribosylformylglycinamidine cyclo-ligase; SPTR:
FT                   Q46E56 Phosphoribosylformylglycinamidine cyclo-ligase;
FT                   TIGRFAM: phosphoribosylformylglycinamidine cyclo-ligase;
FT                   PFAM: AIR synthase related protein, N-terminal domain; AIR
FT                   synthase related protein, C-terminal domain; TIGRFAM:
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35753"
FT                   /db_xref="GOA:D5E9A2"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A2"
FT                   /protein_id="ADE35753.1"
FT                   /translation="MDKKLTYADSGVDIHQEESTIGNLTGDMTYTREGLGAPMTSIGHY
FT                   AGLMDFGDFALAMATDGVGSKVLIANEMEKWDTMGIDCIAMNVNDLIAIGAEPISFVDY
FT                   LAIEKHSDEFARQIGVGLAKGAEISRMSILGGETATLPEIVKGFDLAGTCLGKVDKDAI
FT                   ITGEKVAEGDVLVGVPSSGVHSNGYTLVRKIIENSKYSYHDPLPYDSSRTIGEELLTPT
FT                   RIYMEVLDTIRKCEVHGLAHITGSGLLKLRRVSELGFDITDPIEPPEIFRFLQKEGNVE
FT                   ELEMYRTFNMGMGFLLIVPPHEAQKVAEIVDGKIVGRITEKDIRVKDLIIE"
     MDKKLTYADS GVDIHQEEST IGNLTGDMTY TREGLGAPMT SIGHYAGLMD FGDFALAMAT        60
     DGVGSKVLIA NEMEKWDTMG IDCIAMNVND LIAIGAEPIS FVDYLAIEKH SDEFARQIGV       120
     GLAKGAEISR MSILGGETAT LPEIVKGFDL AGTCLGKVDK DAIITGEKVA EGDVLVGVPS       180
     SGVHSNGYTL VRKIIENSKY SYHDPLPYDS SRTIGEELLT PTRIYMEVLD TIRKCEVHGL       240
     AHITGSGLLK LRRVSELGFD ITDPIEPPEI FRFLQKEGNV EELEMYRTFN MGMGFLLIVP       300
     PHEAQKVAEI VDGKIVGRIT EKDIRVKDLI IE                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page