(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE216

CP001994.PE216       Location/Qualifiers
FT   CDS             complement(248233..249615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0221"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="COGs: COG0527 Aspartokinase; InterPro
FT                   IPR002912:IPR001048:IPR005260:IPR001341; KEGG: hypothetical
FT                   protein; K00928 aspartate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; amino acid-binding
FT                   ACT domain protein; PRIAM: Aspartate kinase; SPTR: Q12UL7
FT                   Aspartokinase; TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: Amino acid kinase family; ACT
FT                   domain; TIGRFAM: aspartate kinase, monofunctional class;
FT                   aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35754"
FT                   /db_xref="GOA:D5E9A3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A3"
FT                   /protein_id="ADE35754.1"
FT                   /translation="MKFGGTSIEKGDKIRHVAELLKDYREQGHEIVAVTSALGGVTDGL
FT                   MEIGIDASHKGKVSQVKEFMADLAKKHYDAIEIAIDDAGIADETIRTIDALIDELEKAL
FT                   IGICYLGELSPRSIDYISSYGERLAAPVVSGAVQSQGIDSSSFTGGEAGIVTNSEYGCA
FT                   RPFEKTYESVGNILKKVVATQVPIVTGFIAENEEGIITTLGRSGSDFTASIIGAGIDAD
FT                   EIWLWKEVHGIMTSDPRIVPNARPIPQISYIEAMELSYFGAKVLHPRTIEPAIKHGIPV
FT                   RVKNTFDPEFEGTLIVSDQRLRKDVVKAVTLIRSVAAINISGAGMVGAIGTAARVFSTL
FT                   AKAGVNIIMISQSSSEANMSFVVDEAHLEDAVASLKSEMNRDVIGEVACDRDICVIAVV
FT                   GAGMDGIPGVAGRVFSTLGKEKINVIMISQGSSQHNISFVVSSDEAEEAVRLLNHEFEL
FT                   GT"
     MKFGGTSIEK GDKIRHVAEL LKDYREQGHE IVAVTSALGG VTDGLMEIGI DASHKGKVSQ        60
     VKEFMADLAK KHYDAIEIAI DDAGIADETI RTIDALIDEL EKALIGICYL GELSPRSIDY       120
     ISSYGERLAA PVVSGAVQSQ GIDSSSFTGG EAGIVTNSEY GCARPFEKTY ESVGNILKKV       180
     VATQVPIVTG FIAENEEGII TTLGRSGSDF TASIIGAGID ADEIWLWKEV HGIMTSDPRI       240
     VPNARPIPQI SYIEAMELSY FGAKVLHPRT IEPAIKHGIP VRVKNTFDPE FEGTLIVSDQ       300
     RLRKDVVKAV TLIRSVAAIN ISGAGMVGAI GTAARVFSTL AKAGVNIIMI SQSSSEANMS       360
     FVVDEAHLED AVASLKSEMN RDVIGEVACD RDICVIAVVG AGMDGIPGVA GRVFSTLGKE       420
     KINVIMISQG SSQHNISFVV SSDEAEEAVR LLNHEFELGT                             460
//

If you have problems or comments...

PBIL Back to PBIL home page