(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE218

CP001994.PE218       Location/Qualifiers
FT   CDS             250956..252140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0223"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.1"
FT                   /note="COGs: COG3635 phosphoglycerate mutase AP
FT                   superfamily; InterPro
FT                   IPR019304:IPR006124:IPR004456:IPR013371; KEGG:
FT                   pca:Pcar_1514 cofactor-independent phosphoglycerate mutase;
FT                   PFAM: 2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; metalloenzyme domain protein; PRIAM:
FT                   Phosphoglycerate mutase; SPTR: Q12UL5
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; TIGRFAM: proposed homoserine kinase;
FT                   phosphonopyruvate decarboxylase-related protein; PFAM:
FT                   Metalloenzyme superfamily;
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; TIGRFAM: 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase, archaeal form; proposed homoserine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35756"
FT                   /db_xref="GOA:D5E9A5"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A5"
FT                   /protein_id="ADE35756.1"
FT                   /translation="MKHIVLIGDGMADYPIKELGDKTVLEAADTPHMDRMALEGINGLA
FT                   TNVPDGMPAGSDVANMSVLGYDPAKHYSGRAPLEAASMGIELDKNDVAFRCNLITIENG
FT                   DILDHSAGHISTEEASQLMQAIEDELGGDVHFYPGISYRHLMVAQFGADAVCTPPHDVV
FT                   EEPALDHMPRGDSAEKLQELIRASWNILSEHPVNKKRIEEGKRPANSIWLWGQGYAPSM
FT                   PSFEEMYGLKAAVISAVDLIKGLGICEGMDVIEVPGATGYLDTNYVGKAEYALESLKDH
FT                   DIVFVHVEAPDEAGHMGSLEAKIQAVEDFDSKVVGTILEGIEKLSEECTVLVLPDHPTP
FT                   IAVRTHTPDPVPFVIYPSFNRDADIVKTYSEDAATDGILSTVRGCDLIRTMLSL"
     MKHIVLIGDG MADYPIKELG DKTVLEAADT PHMDRMALEG INGLATNVPD GMPAGSDVAN        60
     MSVLGYDPAK HYSGRAPLEA ASMGIELDKN DVAFRCNLIT IENGDILDHS AGHISTEEAS       120
     QLMQAIEDEL GGDVHFYPGI SYRHLMVAQF GADAVCTPPH DVVEEPALDH MPRGDSAEKL       180
     QELIRASWNI LSEHPVNKKR IEEGKRPANS IWLWGQGYAP SMPSFEEMYG LKAAVISAVD       240
     LIKGLGICEG MDVIEVPGAT GYLDTNYVGK AEYALESLKD HDIVFVHVEA PDEAGHMGSL       300
     EAKIQAVEDF DSKVVGTILE GIEKLSEECT VLVLPDHPTP IAVRTHTPDP VPFVIYPSFN       360
     RDADIVKTYS EDAATDGILS TVRGCDLIRT MLSL                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page