(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE224

CP001994.PE224       Location/Qualifiers
FT   CDS             256877..257908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0229"
FT                   /product="Replication factor C"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   InterPro IPR013748; KEGG: hypothetical protein; K10756
FT                   replication factor C subunit 3/5; PFAM: Replication factor
FT                   C; SPTR: Q12UK9 Replication factor C small subunit; PFAM:
FT                   ATPase family associated with various cellular activities
FT                   (AAA); Replication factor C"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35762"
FT                   /db_xref="GOA:D5E9B1"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B1"
FT                   /protein_id="ADE35762.1"
FT                   /translation="MKDLWTLKYRPQELGDFVGNEKAVSIMQHLVSAGKLPHLVIHGPA
FT                   GSGKASAVFALARGIYGDNFEHNFTYFNASDFFDQGKRYLVRDKRFVRILGTDDPKKIR
FT                   SSVISIFKDLVNEYASMGSIDADYKIIFVDSAESLNESAQHALRRIMERYSRTCRFIFS
FT                   TTQPSRLISPLRSRGLQLFFTYVSDEELVSFLGSVADSEGLAYDPEALGGLARHCKGNV
FT                   DCALRLLQSAALQHSGKKLSADIIFEVVMEDVPAGISSLQEAISAADFPRARKAIDKML
FT                   IEEGMSGVEIVRHLHRVVSDAGESPAILARILLKIADADLNVRSAANDRIHLERLVTEM
FT                   ANV"
     MKDLWTLKYR PQELGDFVGN EKAVSIMQHL VSAGKLPHLV IHGPAGSGKA SAVFALARGI        60
     YGDNFEHNFT YFNASDFFDQ GKRYLVRDKR FVRILGTDDP KKIRSSVISI FKDLVNEYAS       120
     MGSIDADYKI IFVDSAESLN ESAQHALRRI MERYSRTCRF IFSTTQPSRL ISPLRSRGLQ       180
     LFFTYVSDEE LVSFLGSVAD SEGLAYDPEA LGGLARHCKG NVDCALRLLQ SAALQHSGKK       240
     LSADIIFEVV MEDVPAGISS LQEAISAADF PRARKAIDKM LIEEGMSGVE IVRHLHRVVS       300
     DAGESPAILA RILLKIADAD LNVRSAANDR IHLERLVTEM ANV                         343
//

If you have problems or comments...

PBIL Back to PBIL home page