(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE225

CP001994.PE225       Location/Qualifiers
FT   CDS             257901..259532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0230"
FT                   /product="histone acetyltransferase, ELP3 family"
FT                   /EC_number="2.3.1.48"
FT                   /note="COGs: COG1243 Histone acetyltransferase; InterPro
FT                   IPR000182:IPR007197:IPR006638:IPR005910; KEGG: elpc-3;
FT                   ELongator complex Protein Component; K07739 elongator
FT                   complex protein 3; PFAM: GCN5-related N-acetyltransferase;
FT                   Radical SAM domain protein; PRIAM: Histone
FT                   acetyltransferase; SMART: Elongator protein 3/MiaB/NifB;
FT                   SPTR: Q12UK8 Histone acetyltransferase, ELP3 family;
FT                   TIGRFAM: histone acetyltransferase, ELP3 family; PFAM:
FT                   Acetyltransferase (GNAT) family; Radical SAM superfamily;
FT                   TIGRFAM: histone acetyltransferase, ELP3 family; radical
FT                   SAM protein, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35763"
FT                   /db_xref="GOA:D5E9B2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR034687"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B2"
FT                   /protein_id="ADE35763.1"
FT                   /translation="MSDESDFAKACRKLVELVLEDSTLDKVQFNREKLNISRQYGLSTL
FT                   PRNSDVIAAASDSEKESVRGLLRRKPVRTISGVAVIAVMTSPAPCPHGVCVPCPGGPAS
FT                   SFVSPQSYMGREPAAMRGIQYEYDPYRIVHARLKQLQEIGHEVDKAELIVMGGTFTSRN
FT                   LDYQEWFTKRCLEAMNDFKGHQWRDSVHNVYGYIPIEDVQEANESSAVRNIGITYETRP
FT                   DWTSPVEVDRLLNFGATKVEIGVQSVYDFVLSRMRRGHSVADTAEANRILRDSGLKVGF
FT                   HMMPRLPGSDNERDMRGFKKLFSDSRFMPDFLKIYPTLVTEGTELEKMWRAGKYDPLYD
FT                   EEAVELLADIKAILPKWVRLQRIQRDIPAQQILAGVKKSNIRQLAGQQLMQKGGKCSCI
FT                   RCREVGHNILKERPPSIEDIEFMVQSYFSCGGQEHFLSFEDVSQDILIGFLRLRFPNKP
FT                   HRPELENSALVRELHVYGSMVAVGGFAKGHDWQHRGYGLRLISEAENMAKDAGFEKLSI
FT                   ISGIGVREYYRKLGYILEGPYMVKYL"
     MSDESDFAKA CRKLVELVLE DSTLDKVQFN REKLNISRQY GLSTLPRNSD VIAAASDSEK        60
     ESVRGLLRRK PVRTISGVAV IAVMTSPAPC PHGVCVPCPG GPASSFVSPQ SYMGREPAAM       120
     RGIQYEYDPY RIVHARLKQL QEIGHEVDKA ELIVMGGTFT SRNLDYQEWF TKRCLEAMND       180
     FKGHQWRDSV HNVYGYIPIE DVQEANESSA VRNIGITYET RPDWTSPVEV DRLLNFGATK       240
     VEIGVQSVYD FVLSRMRRGH SVADTAEANR ILRDSGLKVG FHMMPRLPGS DNERDMRGFK       300
     KLFSDSRFMP DFLKIYPTLV TEGTELEKMW RAGKYDPLYD EEAVELLADI KAILPKWVRL       360
     QRIQRDIPAQ QILAGVKKSN IRQLAGQQLM QKGGKCSCIR CREVGHNILK ERPPSIEDIE       420
     FMVQSYFSCG GQEHFLSFED VSQDILIGFL RLRFPNKPHR PELENSALVR ELHVYGSMVA       480
     VGGFAKGHDW QHRGYGLRLI SEAENMAKDA GFEKLSIISG IGVREYYRKL GYILEGPYMV       540
     KYL                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page