(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE226

CP001994.PE226       Location/Qualifiers
FT   CDS             259619..259960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0231"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UK7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35764"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B3"
FT                   /protein_id="ADE35764.1"
FT                   /translation="MVSEVEMNNILVALNEINDKIDRLLFQQDSSSHASQEDGLDELDV
FT                   MTLLSLPDHLRTTATVLFEMGTATAAQISEKTSKERAVESNYLNQLVRMGHVHKYRNGR
FT                   KVFFTILST"
     MVSEVEMNNI LVALNEINDK IDRLLFQQDS SSHASQEDGL DELDVMTLLS LPDHLRTTAT        60
     VLFEMGTATA AQISEKTSKE RAVESNYLNQ LVRMGHVHKY RNGRKVFFTI LST              113
//

If you have problems or comments...

PBIL Back to PBIL home page