(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE231

CP001994.PE231       Location/Qualifiers
FT   CDS             complement(263683..264006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0236"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UK1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35769"
FT                   /db_xref="GOA:D5E9B8"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B8"
FT                   /protein_id="ADE35769.1"
FT                   /translation="MKKQTQKSGGKALFGKDITEYLRFYKMGLLLVAGLGIYLGLLGLY
FT                   LIIVDNNYIPGIALFIAALLISPPPIGISNMIIRYFNIELSMGLKLGIATMLLFIAWWQ
FT                   LGF"
     MKKQTQKSGG KALFGKDITE YLRFYKMGLL LVAGLGIYLG LLGLYLIIVD NNYIPGIALF        60
     IAALLISPPP IGISNMIIRY FNIELSMGLK LGIATMLLFI AWWQLGF                     107
//

If you have problems or comments...

PBIL Back to PBIL home page