(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE233

CP001994.PE233       Location/Qualifiers
FT   CDS             complement(265368..266174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0238"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="COGs: COG0169 Shikimate 5-dehydrogenase; InterPro
FT                   IPR013708:IPR006151:IPR011342; KEGG: dps:DP3012 shikimate
FT                   5-dehydrogenase; PFAM: Shikimate/quinate 5-dehydrogenase;
FT                   Shikimate dehydrogenase substrate binding domain protein;
FT                   SPTR: Q8THC3 Shikimate dehydrogenase; TIGRFAM: shikimate
FT                   5-dehydrogenase; PFAM: Shikimate dehydrogenase substrate
FT                   binding domain; Shikimate / quinate 5-dehydrogenase;
FT                   TIGRFAM: shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35771"
FT                   /db_xref="GOA:D5E9C0"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C0"
FT                   /protein_id="ADE35771.1"
FT                   /translation="MKKVFGVLGDPIEHSLSPAMHNAAFRELEMDCEYHAFRVRHKYLK
FT                   NAILGAQAMGFGGLNITVPHKEKALEFTNPDTLARRIGAVNTVSFNDGIRGHNTDGLGA
FT                   EMALLEAGVGINASNVVLVGAGGAARAIAFHFAEKGAGVTIANRTPEKAEVLAEDVGCS
FT                   HAGLENLKELLQDSDILINATSAGMHPHIDSTIASRDILHPGLAVFDIVYNPLQTKLLH
FT                   QAELAGAKPIGGVAMLVHQGAEAFRIWTGQKPPVEVMRNAVLEGLG"
     MKKVFGVLGD PIEHSLSPAM HNAAFRELEM DCEYHAFRVR HKYLKNAILG AQAMGFGGLN        60
     ITVPHKEKAL EFTNPDTLAR RIGAVNTVSF NDGIRGHNTD GLGAEMALLE AGVGINASNV       120
     VLVGAGGAAR AIAFHFAEKG AGVTIANRTP EKAEVLAEDV GCSHAGLENL KELLQDSDIL       180
     INATSAGMHP HIDSTIASRD ILHPGLAVFD IVYNPLQTKL LHQAELAGAK PIGGVAMLVH       240
     QGAEAFRIWT GQKPPVEVMR NAVLEGLG                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page