(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE238

CP001994.PE238       Location/Qualifiers
FT   CDS             complement(269567..270394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0243"
FT                   /product="Endonuclease IV"
FT                   /EC_number="3.1.21.-"
FT                   /note="COGs: COG0648 Endonuclease IV; InterPro
FT                   IPR012307:IPR001719; KEGG: dma:DMR_37530 putative
FT                   endonuclease IV; PFAM: Xylose isomerase domain protein TIM
FT                   barrel; SMART: AP endonuclease family 2; SPTR: Q12UI4
FT                   Endonuclease IV; PFAM: Xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35776"
FT                   /db_xref="GOA:D5E9C5"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C5"
FT                   /protein_id="ADE35776.1"
FT                   /translation="MSLLFGTAGTPLSAKGRGSEGGVRRVKELGLGCMELEFVRGVRMK
FT                   EPTAEKIADTARKTGISLSVHAPYYINLNSKEEEKIQASIKRIYDSAYIGNICGAGSIV
FT                   FHPAYYHEQNGNTVFSKVESLLEELAGQLEDEGINATLRPETTGKPSQFGNLEETLALS
FT                   ASIEGVMPCIDFAHLHARSKGEENSYAEFSAVLEKVEEYLGKEGLRNMHMHISGIEYTD
FT                   KGEKNHLVLEESDLNFSELMQALKDFRAQGLVICESPNLEQDALLLQKTYENK"
     MSLLFGTAGT PLSAKGRGSE GGVRRVKELG LGCMELEFVR GVRMKEPTAE KIADTARKTG        60
     ISLSVHAPYY INLNSKEEEK IQASIKRIYD SAYIGNICGA GSIVFHPAYY HEQNGNTVFS       120
     KVESLLEELA GQLEDEGINA TLRPETTGKP SQFGNLEETL ALSASIEGVM PCIDFAHLHA       180
     RSKGEENSYA EFSAVLEKVE EYLGKEGLRN MHMHISGIEY TDKGEKNHLV LEESDLNFSE       240
     LMQALKDFRA QGLVICESPN LEQDALLLQK TYENK                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page