(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE239

CP001994.PE239       Location/Qualifiers
FT   CDS             complement(270396..270725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0244"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UI2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35777"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C6"
FT                   /protein_id="ADE35777.1"
FT                   /translation="MGREFTDRDMDIFNKLAPEAGGNNISQMGHPYPFILRPISHRFAE
FT                   SGEDFRNRLEKLDRADVEYLADLAIEGKEDVRGLEDEDMDSFFSVLEGFSPEKLEELKD
FT                   KLGMI"
     MGREFTDRDM DIFNKLAPEA GGNNISQMGH PYPFILRPIS HRFAESGEDF RNRLEKLDRA        60
     DVEYLADLAI EGKEDVRGLE DEDMDSFFSV LEGFSPEKLE ELKDKLGMI                   109
//

If you have problems or comments...

PBIL Back to PBIL home page