(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE24

CP001994.PE24        Location/Qualifiers
FT   CDS             24183..25502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0024"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="COGs: COG0358 DNA primase; InterPro
FT                   IPR006171:IPR006154; KEGG: spe:Spro_4299 DNA primase; PFAM:
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein;
FT                   SPTR: Q12V67 UPF0095 protein Mbur_1769; PFAM: Toprim
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35562"
FT                   /db_xref="GOA:D5E8Q3"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR020607"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q3"
FT                   /protein_id="ADE35562.1"
FT                   /translation="MQSTDTTKYIIHSKINADGVIERPDIVGAIFGQTEGLLGSDLDLR
FT                   DLQKTGRIGRIEVIVSTKGGKTKGNIHIPSSLDRIETSILAASLETIDRVGPCSANIEV
FT                   SNIEDVRATKRKHIVERAKFILTGMFDANLPESQEIADEVRQSVRVEEMQFFGKNKNIP
FT                   CGPNVLDSDAIVVVEGRADVLNLLRYGIKNAICVGGTNVPPEVAELTRKKTVTAFTDGD
FT                   RGGKLIIKELLQVADIDYVARAPDGKTVEDLVQREIIRALRQKVPVEQAMEAYSIDKPA
FT                   EKTTTPSSSGPKKGGRIARVPKREKRVKPDRARNPAAKMKKIAEPPIKKEKPKPSSTKP
FT                   ATSQHPVLKRLSSHSESLAGTLGARLLDQDDKVVNETPVRDLVNTLKNSEDNVKSVVFD
FT                   GVVTQRILDIASNKGIDTLIGVKKGNITKSPANVKVYTSA"
     MQSTDTTKYI IHSKINADGV IERPDIVGAI FGQTEGLLGS DLDLRDLQKT GRIGRIEVIV        60
     STKGGKTKGN IHIPSSLDRI ETSILAASLE TIDRVGPCSA NIEVSNIEDV RATKRKHIVE       120
     RAKFILTGMF DANLPESQEI ADEVRQSVRV EEMQFFGKNK NIPCGPNVLD SDAIVVVEGR       180
     ADVLNLLRYG IKNAICVGGT NVPPEVAELT RKKTVTAFTD GDRGGKLIIK ELLQVADIDY       240
     VARAPDGKTV EDLVQREIIR ALRQKVPVEQ AMEAYSIDKP AEKTTTPSSS GPKKGGRIAR       300
     VPKREKRVKP DRARNPAAKM KKIAEPPIKK EKPKPSSTKP ATSQHPVLKR LSSHSESLAG       360
     TLGARLLDQD DKVVNETPVR DLVNTLKNSE DNVKSVVFDG VVTQRILDIA SNKGIDTLIG       420
     VKKGNITKSP ANVKVYTSA                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page