(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE241

CP001994.PE241       Location/Qualifiers
FT   CDS             271745..273103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0247"
FT                   /product="MATE efflux family protein"
FT                   /note="COGs: COG0534 Na+-driven multidrug efflux pump;
FT                   InterPro IPR002528; KEGG: dal:Dalk_2553 MATE efflux family
FT                   protein; PFAM: multi antimicrobial extrusion protein MatE;
FT                   SPTR: Q8TTU1 Uncharacterized membrane protein; TIGRFAM:
FT                   MATE efflux family protein; PFAM: MatE; TIGRFAM: putative
FT                   efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35779"
FT                   /db_xref="GOA:D5E9C8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C8"
FT                   /protein_id="ADE35779.1"
FT                   /translation="MKEQSRALGVESVGKLLFRLSAPATVGMVVMGLYNIVDTIFVGRA
FT                   LGGESVQGIGGIAVSFPVIMIAMAVSLAIGLGGSSIISRRLGGDDLEGAERTFGNMVGL
FT                   SLSLGFLVFIFGSFFIVPILKAFGATPTILPFARDYLQIILYGTPLITFSQAINNVVRS
FT                   EGNAKVAMYTMLIGAGLNILLDPILIFGLDMGIRGAAAATVISQFATTIFLVHYFLSGK
FT                   SSLQFHTGFMRPDMEIIKEMVAIGASPFARNSSTSAIVVVVNNILALYGGDVSIAIYGI
FT                   FNRMLMFSFMPMIGLLQGMQPIIGFNYGAHNFERVRETLRICVLISSVIAVAAFLLLFF
FT                   FGSNLFSIFTTDATLIKEGTDATKIMVLAIPLLGIQFVSGGMYQALGKARPSFILSTAR
FT                   QVFLLPLVLVLPWFFDTTGVWIAFPVSDLLAVLLAVYMFMKEYRLLEWRASVS"
     MKEQSRALGV ESVGKLLFRL SAPATVGMVV MGLYNIVDTI FVGRALGGES VQGIGGIAVS        60
     FPVIMIAMAV SLAIGLGGSS IISRRLGGDD LEGAERTFGN MVGLSLSLGF LVFIFGSFFI       120
     VPILKAFGAT PTILPFARDY LQIILYGTPL ITFSQAINNV VRSEGNAKVA MYTMLIGAGL       180
     NILLDPILIF GLDMGIRGAA AATVISQFAT TIFLVHYFLS GKSSLQFHTG FMRPDMEIIK       240
     EMVAIGASPF ARNSSTSAIV VVVNNILALY GGDVSIAIYG IFNRMLMFSF MPMIGLLQGM       300
     QPIIGFNYGA HNFERVRETL RICVLISSVI AVAAFLLLFF FGSNLFSIFT TDATLIKEGT       360
     DATKIMVLAI PLLGIQFVSG GMYQALGKAR PSFILSTARQ VFLLPLVLVL PWFFDTTGVW       420
     IAFPVSDLLA VLLAVYMFMK EYRLLEWRAS VS                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page