(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE244

CP001994.PE244       Location/Qualifiers
FT   CDS             complement(274898..275155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0250"
FT                   /product="PRC-barrel domain protein"
FT                   /note="InterPro IPR007903; PFAM: PRC-barrel domain protein;
FT                   SPTR: Q12UG5 PRC-barrel protein; PFAM: PRC-barrel domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35782"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D1"
FT                   /protein_id="ADE35782.1"
FT                   /translation="MPKVFAKNLSNKQVMTTDGTEIGILDNIVMEVKTGKLEDLMVKPD
FT                   IGLDTSKYVTDGQFLKIPFKAVRSIKDYIVVDKQIATNLD"
     MPKVFAKNLS NKQVMTTDGT EIGILDNIVM EVKTGKLEDL MVKPDIGLDT SKYVTDGQFL        60
     KIPFKAVRSI KDYIVVDKQI ATNLD                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page