(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE245

CP001994.PE245       Location/Qualifiers
FT   CDS             complement(275173..277404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0251"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.1.3"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class;
FT                   InterProIPR004201:IPR003959:IPR011704:IPR003338:IPR
FT                   003593:IPR003960:IPR005938; KEGG: gur:Gura_2842 AAA family
FT                   ATPase, CDC48 subfamily protein; PFAM: AAA ATPase central
FT                   domain protein; cell division protein 48 CDC48 domain 2;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   AAA ATPase VAT domain protein; PRIAM:
FT                   Adenosinetriphosphatase; SMART: AAA ATPase; SPTR: Q12UG4
FT                   AAA family ATPase, CDC48 subfamily; TIGRFAM: AAA family
FT                   ATPase, CDC48 subfamily; PFAM: Cell division protein 48
FT                   (CDC48), N-terminal domain; ATPase family associated with
FT                   various cellular activities (AAA); Cell division protein 48
FT                   (CDC48), domain 2; TIGRFAM: AAA family ATPase, CDC48
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35783"
FT                   /db_xref="GOA:D5E9D2"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D2"
FT                   /protein_id="ADE35783.1"
FT                   /translation="MEELQIKVEKAHPIDFGRGIIRLDPSTLLSLQLSPGDIVLIEGKR
FT                   QTTAKVWRADRQDWGQGIARIDGYTRQNAEVGIGERITLSKAEPIPAEKILLAPPEGIV
FT                   MEFGDNTSAVIKHNILKRPFVKGDIIPIISSMGQTTPGSQAIPLIAVDTEPSDGILIIN
FT                   ENTQIQLQQKPVVGYEGAARGINYEDIGGLRTEIQRVREMIELPLKHHELFLRLNIDPP
FT                   KGVILYGPPGTGKTLIARAVASESNAYFINIAGPEIMGKYYGESEERLRKIFDEAAENA
FT                   PSIIFVDEIDSIAPKREDVTGEVERRVVAQLLTLMDGMDERKQVVVIAATNRLDSIDPA
FT                   LRRPGRFDREIEIGVPDSEDRLEILQIHTRGMPLNENIDEEYFEHLAEYTQGFVGADLL
FT                   ALVQEASMRALRRLLPDINLDEEEIPQEILEKLEVTPDDFEEALKEIEPSAMREVMVEI
FT                   PSVGWDDIGGLDLARQDISEAVEWPLKWPDKISQMGIKPPTGILLYGPPGTGKTLLAQA
FT                   VANEANANFISVKGPQILSKYVGESEKAIRDTFKKARQVAPCIIFFDEIDAISSTRQGG
FT                   SDVGSRVSEQVVNQMLTEMDGLEPLNEVVVIAATNRPDLIDPALLRSGRFDRLVMVGAA
FT                   LAEGREKIFRIHTMGIPLDSDVDIRELATMTEGYVGSDIESICREAAMLSLREDFDNEK
FT                   VSKRHFLSAMEKVKPTVNEDMIDFYNRVQEKLKGGSIRKTDAGSFAGYI"
     MEELQIKVEK AHPIDFGRGI IRLDPSTLLS LQLSPGDIVL IEGKRQTTAK VWRADRQDWG        60
     QGIARIDGYT RQNAEVGIGE RITLSKAEPI PAEKILLAPP EGIVMEFGDN TSAVIKHNIL       120
     KRPFVKGDII PIISSMGQTT PGSQAIPLIA VDTEPSDGIL IINENTQIQL QQKPVVGYEG       180
     AARGINYEDI GGLRTEIQRV REMIELPLKH HELFLRLNID PPKGVILYGP PGTGKTLIAR       240
     AVASESNAYF INIAGPEIMG KYYGESEERL RKIFDEAAEN APSIIFVDEI DSIAPKREDV       300
     TGEVERRVVA QLLTLMDGMD ERKQVVVIAA TNRLDSIDPA LRRPGRFDRE IEIGVPDSED       360
     RLEILQIHTR GMPLNENIDE EYFEHLAEYT QGFVGADLLA LVQEASMRAL RRLLPDINLD       420
     EEEIPQEILE KLEVTPDDFE EALKEIEPSA MREVMVEIPS VGWDDIGGLD LARQDISEAV       480
     EWPLKWPDKI SQMGIKPPTG ILLYGPPGTG KTLLAQAVAN EANANFISVK GPQILSKYVG       540
     ESEKAIRDTF KKARQVAPCI IFFDEIDAIS STRQGGSDVG SRVSEQVVNQ MLTEMDGLEP       600
     LNEVVVIAAT NRPDLIDPAL LRSGRFDRLV MVGAALAEGR EKIFRIHTMG IPLDSDVDIR       660
     ELATMTEGYV GSDIESICRE AAMLSLREDF DNEKVSKRHF LSAMEKVKPT VNEDMIDFYN       720
     RVQEKLKGGS IRKTDAGSFA GYI                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page