(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE248

CP001994.PE248       Location/Qualifiers
FT   CDS             278302..279348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0254"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="InterPro IPR000326; KEGG: efe:EFER_1728 putative
FT                   membrane protein, putative acid
FT                   phosphatase/vanadium-dependent haloperoxidase; PFAM:
FT                   phosphoesterase PA-phosphatase related; SPTR: Q46AZ8
FT                   Putative uncharacterized protein; PFAM: PAP2 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35786"
FT                   /db_xref="GOA:D5E9D5"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D5"
FT                   /protein_id="ADE35786.1"
FT                   /translation="MYSFIQLLLSEIISSFSGQWLSQYMMTIVMIPLLFLMVTAGYVLF
FT                   VPVENRRPEFSSMKGFFHFVVDVVIYAIPMLIVYALVHMQTTAATLLGVPANQNYAHYI
FT                   MILEGDVVSLIQEIATPLLTYASGFFYLLMFPFLLTFTFLLLVYLQRHKAVQEFVVAFI
FT                   LIYLLAFPFYILFPVHVTGYTLSGVSPLLYNLSPFIAEGVRIVDPDLNNCFPSLHTALS
FT                   VMAMIMVLHNVKSRRYQAFAVITTAAILFTILYLGIHWLSDLVGGTLLAIVCCLIAFRY
FT                   SEHLFSIYRWIVAMLSWKLKGPALPCVGCNRRINFDSVMQCDYCGTEYNIKGRVFSLLK
FT                   RFRKRFSP"
     MYSFIQLLLS EIISSFSGQW LSQYMMTIVM IPLLFLMVTA GYVLFVPVEN RRPEFSSMKG        60
     FFHFVVDVVI YAIPMLIVYA LVHMQTTAAT LLGVPANQNY AHYIMILEGD VVSLIQEIAT       120
     PLLTYASGFF YLLMFPFLLT FTFLLLVYLQ RHKAVQEFVV AFILIYLLAF PFYILFPVHV       180
     TGYTLSGVSP LLYNLSPFIA EGVRIVDPDL NNCFPSLHTA LSVMAMIMVL HNVKSRRYQA       240
     FAVITTAAIL FTILYLGIHW LSDLVGGTLL AIVCCLIAFR YSEHLFSIYR WIVAMLSWKL       300
     KGPALPCVGC NRRINFDSVM QCDYCGTEYN IKGRVFSLLK RFRKRFSP                    348
//

If you have problems or comments...

PBIL Back to PBIL home page