(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE249

CP001994.PE249       Location/Qualifiers
FT   CDS             complement(279354..280382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0392 integral membrane protein; InterPro
FT                   IPR005242; KEGG: maq:Maqu_3008 hypothetical protein; PFAM:
FT                   conserved hypothetical protein; SPTR: Q12TG6 Putative
FT                   uncharacterized protein; PFAM: Uncharacterised protein
FT                   family (UPF0104); TIGRFAM: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35787"
FT                   /db_xref="GOA:D5E9D6"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D6"
FT                   /protein_id="ADE35787.1"
FT                   /translation="MNKFAKWLAVSFIISIITMVGVFIYTIDPKTTESLYNIRPLYLLA
FT                   AASIHMMGFVMWSIRTKMMAGALGYHVSIKKSFEIVTSSSFLASMTPSSVGGEPLRIHL
FT                   LQKDRMPVGSATAVVLGERVLDAIIILTAAPFALSLFGEVLGGGKLDSLLMFGQLFLFF
FT                   ILAILLYAIWKPHYTRRFLQWVVNKCSRLFGDDKKHVFCKISEKVDTELEEFHYSIFVF
FT                   LKEGRWGLLAGILFTFAFWFIEFSMLPVLLMGLNQYPSAIIVYAAQVLLMIVVIIPATP
FT                   GSSGVAEIGATTLFSVFVPTYVLGIVVVAWRALTFYLNLLVGGFVSFKILKDTVEVDEL
FT                   LK"
     MNKFAKWLAV SFIISIITMV GVFIYTIDPK TTESLYNIRP LYLLAAASIH MMGFVMWSIR        60
     TKMMAGALGY HVSIKKSFEI VTSSSFLASM TPSSVGGEPL RIHLLQKDRM PVGSATAVVL       120
     GERVLDAIII LTAAPFALSL FGEVLGGGKL DSLLMFGQLF LFFILAILLY AIWKPHYTRR       180
     FLQWVVNKCS RLFGDDKKHV FCKISEKVDT ELEEFHYSIF VFLKEGRWGL LAGILFTFAF       240
     WFIEFSMLPV LLMGLNQYPS AIIVYAAQVL LMIVVIIPAT PGSSGVAEIG ATTLFSVFVP       300
     TYVLGIVVVA WRALTFYLNL LVGGFVSFKI LKDTVEVDEL LK                          342
//

If you have problems or comments...

PBIL Back to PBIL home page