(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE25

CP001994.PE25        Location/Qualifiers
FT   CDS             25560..26024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0025"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12VJ5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35563"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q4"
FT                   /protein_id="ADE35563.1"
FT                   /translation="MQRRGLLFLLLILILFSSGCSDIGDTVKDVNETVTQSKEDVEYLK
FT                   WMKASIDIIHSDYVDIKQALEDRDVATLEKAAGNLTSHCSKAKGTMQSFNPSPSLQPVT
FT                   DRYSQILNQSCSLGTFLEENAATLNFTNETTLQKVEKNMGLVNNSLILNN"
     MQRRGLLFLL LILILFSSGC SDIGDTVKDV NETVTQSKED VEYLKWMKAS IDIIHSDYVD        60
     IKQALEDRDV ATLEKAAGNL TSHCSKAKGT MQSFNPSPSL QPVTDRYSQI LNQSCSLGTF       120
     LEENAATLNF TNETTLQKVE KNMGLVNNSL ILNN                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page