(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE254

CP001994.PE254       Location/Qualifiers
FT   CDS             complement(283107..284324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0260"
FT                   /product="Protein of unknown function DUF650"
FT                   /note="COGs: COG1602 conserved hypothetical protein;
FT                   InterPro IPR006978:IPR006979; PFAM: Protein of unknown
FT                   function DUF650; Protein of unknown function DUF651; SPTR:
FT                   Q12UF3 Putative uncharacterized protein; PFAM: Archaeal
FT                   protein of unknown function (DUF650); Archaeal protein of
FT                   unknown function (DUF651)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35792"
FT                   /db_xref="GOA:D5E9E1"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E1"
FT                   /protein_id="ADE35792.1"
FT                   /translation="MKTQCIECKGKGLCGRTRCPILEKFRATAKYSPQKQGGKTIFGAS
FT                   PPAIFVGRYGYPEISAGPMIPPLLESDEAAKLEDPHALLGMGIDDIIQKRCQLVRANTT
FT                   VKVKQFEKGRLIEKAQEMALSRKPVDTEVLLSKPLKPAQKFDGVLTPMGPAGKMERFEI
FT                   SENPKVPDKVDYLTYDNDVKATDAALELYGHNIGCEHITRLLSIGLLGQERKLVPTRWA
FT                   ITATDDMVGKELTKDLLDYPEIKDIQLYSGGSLGNHFEILLIPRSYSFELLELWMARTV
FT                   WSADKAWIGQDMEGTSGKKGYSPLAGGYYAARLPVLEKLKSIRKQAAVFAIREITPDYW
FT                   APLGVWVVREAARNALSTEPYSFETLEEALMNMKTRINTPFYQWRDKSKLLPYVKEQTT
FT                   LSRFLP"
     MKTQCIECKG KGLCGRTRCP ILEKFRATAK YSPQKQGGKT IFGASPPAIF VGRYGYPEIS        60
     AGPMIPPLLE SDEAAKLEDP HALLGMGIDD IIQKRCQLVR ANTTVKVKQF EKGRLIEKAQ       120
     EMALSRKPVD TEVLLSKPLK PAQKFDGVLT PMGPAGKMER FEISENPKVP DKVDYLTYDN       180
     DVKATDAALE LYGHNIGCEH ITRLLSIGLL GQERKLVPTR WAITATDDMV GKELTKDLLD       240
     YPEIKDIQLY SGGSLGNHFE ILLIPRSYSF ELLELWMART VWSADKAWIG QDMEGTSGKK       300
     GYSPLAGGYY AARLPVLEKL KSIRKQAAVF AIREITPDYW APLGVWVVRE AARNALSTEP       360
     YSFETLEEAL MNMKTRINTP FYQWRDKSKL LPYVKEQTTL SRFLP                       405
//

If you have problems or comments...

PBIL Back to PBIL home page