(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE255

CP001994.PE255       Location/Qualifiers
FT   CDS             complement(284321..284680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0261"
FT                   /product="transcriptional regulator protein"
FT                   /note="COGs: COG2522 transcriptional regulator protein;
FT                   SPTR: Q12UF2 Putative uncharacterized protein; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35793"
FT                   /db_xref="GOA:D5E9E2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E2"
FT                   /protein_id="ADE35793.1"
FT                   /translation="MKPACEIMVQRVLPAIRAVLARELMNEHKCTQQQVANLLGLSRAA
FT                   VSQYVSEKRGAEVGFSENTNEEIRKFAFCLATDGLTPKQKVKRMCEVCKHVQKSGWLYK
FT                   NAPEVGYCILCGEDD"
     MKPACEIMVQ RVLPAIRAVL ARELMNEHKC TQQQVANLLG LSRAAVSQYV SEKRGAEVGF        60
     SENTNEEIRK FAFCLATDGL TPKQKVKRMC EVCKHVQKSG WLYKNAPEVG YCILCGEDD        119
//

If you have problems or comments...

PBIL Back to PBIL home page