(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE256

CP001994.PE256       Location/Qualifiers
FT   CDS             complement(284857..285165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0262"
FT                   /product="translation initiation factor 1 (eIF-1/SUI1)"
FT                   /note="COGs: COG0023 Translation initiation factor 1
FT                   (eIF-1/SUI1) and related protein; InterPro
FT                   IPR001950:IPR005872; KEGG: hch:HCH_00188 translation
FT                   initiation factor SUI1; PFAM: translation initiation factor
FT                   SUI1; SPTR: Q12UF1 Protein translation factor SUI1 homolog;
FT                   TIGRFAM: translation initiation factor SUI1; PFAM:
FT                   Translation initiation factor SUI1; TIGRFAM: translation
FT                   initation factor SUI1, putative, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35794"
FT                   /db_xref="GOA:D5E9E3"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR022851"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E3"
FT                   /protein_id="ADE35794.1"
FT                   /translation="MSSEMCSVCGLPKELCICEEVAKEQQRITVKVNRRRYGKEVTVVE
FT                   GFDANEIDLHELSTYLKSKFACGGTVRGNAVELQGNHLGRMKDVLVQKGFSPDQIKN"
     MSSEMCSVCG LPKELCICEE VAKEQQRITV KVNRRRYGKE VTVVEGFDAN EIDLHELSTY        60
     LKSKFACGGT VRGNAVELQG NHLGRMKDVL VQKGFSPDQI KN                          102
//

If you have problems or comments...

PBIL Back to PBIL home page