(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE261

CP001994.PE261       Location/Qualifiers
FT   CDS             289465..290745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0267"
FT                   /product="methanogenesis marker protein 1"
FT                   /note="COGs: COG1944 conserved hypothetical protein;
FT                   InterPro IPR003776:IPR017667; KEGG: scl:sce8753
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF181; SPTR: Q12UD2 Putative uncharacterized protein;
FT                   TIGRFAM: methanogenesis marker protein 1; PFAM: YcaO-like
FT                   family; TIGRFAM: uncharacterized domain; putative
FT                   methanogenesis marker protein 1; bacteriocin biosynthesis
FT                   docking scaffold, SagD family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35799"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR017667"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E8"
FT                   /protein_id="ADE35799.1"
FT                   /translation="MPIIDIDPYVKYAGDSQRVLDGEATLEKASGGLDKIGVTRIANIT
FT                   DLDRLGIPVFSGIRPTAADGAISVYSGKGVNPQQARISTIMECYERCLAERNGVNADID
FT                   ENVAADEFMATMEEAGVHHDLIHPEEFLMPQPLDSTSLIEWTEGFDLLSGNEVYVPSNA
FT                   VYHPYDAPGMSAHLFRSNTNGLASGNVMEEAILHGLLEVIERDALSMAEFNRNPGMELV
FT                   LTEEDGHAYEMLKAFRDSGVDIRLWVLLHDTPVTTVVAATDDVQLKDPALLVMGAGSHL
FT                   RPDIAVMRAITEAAQSRVVQIHGAREDTTREDLVRKIGYERMRRMNVYWYEEGVDKISL
FT                   ADMQDISSPTPAGNINTVLSHLEKIARNAVVVDLSRSSINIPVVRVIIPGFEQYTLDRE
FT                   RVGKRIRLVGKRKGPEKEKPWKRRPKV"
     MPIIDIDPYV KYAGDSQRVL DGEATLEKAS GGLDKIGVTR IANITDLDRL GIPVFSGIRP        60
     TAADGAISVY SGKGVNPQQA RISTIMECYE RCLAERNGVN ADIDENVAAD EFMATMEEAG       120
     VHHDLIHPEE FLMPQPLDST SLIEWTEGFD LLSGNEVYVP SNAVYHPYDA PGMSAHLFRS       180
     NTNGLASGNV MEEAILHGLL EVIERDALSM AEFNRNPGME LVLTEEDGHA YEMLKAFRDS       240
     GVDIRLWVLL HDTPVTTVVA ATDDVQLKDP ALLVMGAGSH LRPDIAVMRA ITEAAQSRVV       300
     QIHGAREDTT REDLVRKIGY ERMRRMNVYW YEEGVDKISL ADMQDISSPT PAGNINTVLS       360
     HLEKIARNAV VVDLSRSSIN IPVVRVIIPG FEQYTLDRER VGKRIRLVGK RKGPEKEKPW       420
     KRRPKV                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page