(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE264

CP001994.PE264       Location/Qualifiers
FT   CDS             complement(291858..293153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3174 membrane protein; InterPro IPR003416;
FT                   KEGG: har:HEAR1033 hypothetical protein; SPTR: Q12UC8
FT                   Putative uncharacterized protein; PFAM: MgtC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35802"
FT                   /db_xref="GOA:D5E9F1"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F1"
FT                   /protein_id="ADE35802.1"
FT                   /translation="MEIVPTIGLDPFLFNFLQKLILSLMIGIIIGIEREHRRAEHPVFA
FT                   GVRTYALAAVTGMLATIAGKTIGNDIIVAAAVLIIACSIALIYRTYTMRGKLGMTSALS
FT                   LFCTFLLGILVANGNYLFAIAGGVAITFLTIEKRPLHSFAQNLSNEDILNSLQFLAVAF
FT                   ILYPLVPAEELWGIVDLKATILIVVLVMFIGFISYISLKRFGAGGGISYSGLLGGFVSS
FT                   EATTAALASIAKEKSGFVNAFYIGILLSNLSMFISNLLIALIVDNSGKTTLNMLPPQLL
FT                   MILVVIGIFWKNKNISKKMEGTLDIGSPFALKPALRFGAIFLVLQIFATFANEYAGTYG
FT                   TYVTALGGVASSSAVTASMASLAVKGEISYMLAGETAVIAGIVSTLNKITYIRIAGALE
FT                   LEKRARMTLMILSIVGIIGLVVWIYADVKPVF"
     MEIVPTIGLD PFLFNFLQKL ILSLMIGIII GIEREHRRAE HPVFAGVRTY ALAAVTGMLA        60
     TIAGKTIGND IIVAAAVLII ACSIALIYRT YTMRGKLGMT SALSLFCTFL LGILVANGNY       120
     LFAIAGGVAI TFLTIEKRPL HSFAQNLSNE DILNSLQFLA VAFILYPLVP AEELWGIVDL       180
     KATILIVVLV MFIGFISYIS LKRFGAGGGI SYSGLLGGFV SSEATTAALA SIAKEKSGFV       240
     NAFYIGILLS NLSMFISNLL IALIVDNSGK TTLNMLPPQL LMILVVIGIF WKNKNISKKM       300
     EGTLDIGSPF ALKPALRFGA IFLVLQIFAT FANEYAGTYG TYVTALGGVA SSSAVTASMA       360
     SLAVKGEISY MLAGETAVIA GIVSTLNKIT YIRIAGALEL EKRARMTLMI LSIVGIIGLV       420
     VWIYADVKPV F                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page