(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE27

CP001994.PE27        Location/Qualifiers
FT   CDS             27521..28213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0027"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR001845; PFAM: regulatory protein ArsR;
FT                   SPTR: Q12WV3 Transcriptional regulator, ArsR family; PFAM:
FT                   Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35565"
FT                   /db_xref="GOA:D5E8Q6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q6"
FT                   /protein_id="ADE35565.1"
FT                   /translation="MENDDNTEKVLVLPLNEDSRKITQTLSNEKSLKILELLAKQPMSA
FT                   TSIAEELDMPLTTIKYNLDGLLECELIQVKETKWSRKGREIKIYEPMQKMIVVIPGSNK
FT                   TDRSSILGMLRKYVAMAGAALFAALGIEYLRNFEPLGQTMPPATPAVMSEMPDSNASND
FT                   TTLFAAEAPANATTEAARAAGESAGAGEASSLIPADFLSHIGVWFFFGCLFIIAVLALW
FT                   EIYNRKKV"
     MENDDNTEKV LVLPLNEDSR KITQTLSNEK SLKILELLAK QPMSATSIAE ELDMPLTTIK        60
     YNLDGLLECE LIQVKETKWS RKGREIKIYE PMQKMIVVIP GSNKTDRSSI LGMLRKYVAM       120
     AGAALFAALG IEYLRNFEPL GQTMPPATPA VMSEMPDSNA SNDTTLFAAE APANATTEAA       180
     RAAGESAGAG EASSLIPADF LSHIGVWFFF GCLFIIAVLA LWEIYNRKKV                  230
//

If you have problems or comments...

PBIL Back to PBIL home page