(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE276

CP001994.PE276       Location/Qualifiers
FT   CDS             complement(302385..303425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0282"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="COGs: COG0502 Biotin synthase; InterPro
FT                   IPR007197:IPR006638; KEGG: dat:HRM2_15240 BioB2; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: Q12UB7 Biotin synthase; PFAM: Radical
FT                   SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35814"
FT                   /db_xref="GOA:D5E9G3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023891"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G3"
FT                   /protein_id="ADE35814.1"
FT                   /translation="MDNEQLDKFASSINKGYQLQDQEIRDLLAIEDEEEMQKLFHVARM
FT                   VRDNFFGNKVFLYSFVYFSTYCKNQCSFCYYNCKNKIHRYRLTPDEIEKVCEALENDPI
FT                   HMVDLTMGEDPYYHDHPEKLVSAVRKVKDKLGLPIMISPGVVRKDTLKQMYDNGADFLA
FT                   LYQETYDQELYNKLRVGQVYDQRINCRQDAKEIGYCVEDGILTEIEPEAESTLISLKGL
FT                   RKSNPNMVRVMTFVPQEGTPLASREPGSSKSELKIISILRLMFPDRLIPASLDLEGMEG
FT                   MVYRLDAGANVVTSIIPSGSTLEGVVNYDRELTERNRDAWSVVERLQSMGMEPAKQEDF
FT                   NQILGR"
     MDNEQLDKFA SSINKGYQLQ DQEIRDLLAI EDEEEMQKLF HVARMVRDNF FGNKVFLYSF        60
     VYFSTYCKNQ CSFCYYNCKN KIHRYRLTPD EIEKVCEALE NDPIHMVDLT MGEDPYYHDH       120
     PEKLVSAVRK VKDKLGLPIM ISPGVVRKDT LKQMYDNGAD FLALYQETYD QELYNKLRVG       180
     QVYDQRINCR QDAKEIGYCV EDGILTEIEP EAESTLISLK GLRKSNPNMV RVMTFVPQEG       240
     TPLASREPGS SKSELKIISI LRLMFPDRLI PASLDLEGME GMVYRLDAGA NVVTSIIPSG       300
     STLEGVVNYD RELTERNRDA WSVVERLQSM GMEPAKQEDF NQILGR                      346
//

If you have problems or comments...

PBIL Back to PBIL home page