(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE279

CP001994.PE279       Location/Qualifiers
FT   CDS             complement(306495..308372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0285"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR004358:IPR013655:IPR013656:IPR013767:IPR
FT                   003594:IPR003661:IPR001610:IPR000014:IPR000700:IPR005467;
FT                   KEGG: dal:Dalk_4458 multi-sensor hybrid histidine kinase;
FT                   PFAM: ATP-binding region ATPase domain protein; PAS fold
FT                   domain protein; PAS fold-4 domain protein; PAS fold-3
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAC repeat-containing protein; PAS domain
FT                   containing protein; SPTR: Q8TKN3 Sensor protein; TIGRFAM:
FT                   PAS sensor protein; PFAM: Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase; His Kinase A (phosphoacceptor)
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35817"
FT                   /db_xref="GOA:D5E9G6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G6"
FT                   /protein_id="ADE35817.1"
FT                   /translation="MCNVVYVDILEFNAPVSKSKIFADMIQHSTDAIIYTTPDFTINFV
FT                   NRSAEEMFGWTLPEIKGKPITILHDQELTSQQKKEMFSNLYSGKAHEIEGSRKRKDGST
FT                   FYCQIKISPLFTEKSRIYGYMGIIRDITEEKQNEDSLVKELDLLTGLIGTARVIVTVLD
FT                   RQGKIVYCNPHTEKITGYKLKEIKGDDWFSRFIPVREKERIRSVFKKAICGHPTKGNVN
FT                   PIDTKEGKEIIVEWYDTALKNDEGEVTGLLSIGNDITQRVEAEEKLKTIYENMPGGILM
FT                   IGQDYIIKDVNYRTCEITGYKREELVGQLCDIVCPKGSSSKQCPIWEDGQEEFRGMDTS
FT                   IKCKNGIKKPILKNAQEITIKGDTYILELFQDISQRKNAEENAIEAKKAAEQANQTKSE
FT                   FLANMSHELRTPLNSVIGFSDILSKEVRGKLNDSQKKYVSNITKSGSHLLSLINDILDL
FT                   SKIEAGQKQLEYSSFDLHEALDEISILIKPLISKKNIDLQMDLPPEDSRVYADRKKFKQ
FT                   IMYNLLSNASKFTPDKGTITIVANQEKDKLKVAVQDTGMGIPEADQATIFEPFQQVKSA
FT                   KSSEYKGTGLGLSLARELVEMHGGQVGLKSEVGMGSTFTFTIPDKPNTN"
     MCNVVYVDIL EFNAPVSKSK IFADMIQHST DAIIYTTPDF TINFVNRSAE EMFGWTLPEI        60
     KGKPITILHD QELTSQQKKE MFSNLYSGKA HEIEGSRKRK DGSTFYCQIK ISPLFTEKSR       120
     IYGYMGIIRD ITEEKQNEDS LVKELDLLTG LIGTARVIVT VLDRQGKIVY CNPHTEKITG       180
     YKLKEIKGDD WFSRFIPVRE KERIRSVFKK AICGHPTKGN VNPIDTKEGK EIIVEWYDTA       240
     LKNDEGEVTG LLSIGNDITQ RVEAEEKLKT IYENMPGGIL MIGQDYIIKD VNYRTCEITG       300
     YKREELVGQL CDIVCPKGSS SKQCPIWEDG QEEFRGMDTS IKCKNGIKKP ILKNAQEITI       360
     KGDTYILELF QDISQRKNAE ENAIEAKKAA EQANQTKSEF LANMSHELRT PLNSVIGFSD       420
     ILSKEVRGKL NDSQKKYVSN ITKSGSHLLS LINDILDLSK IEAGQKQLEY SSFDLHEALD       480
     EISILIKPLI SKKNIDLQMD LPPEDSRVYA DRKKFKQIMY NLLSNASKFT PDKGTITIVA       540
     NQEKDKLKVA VQDTGMGIPE ADQATIFEPF QQVKSAKSSE YKGTGLGLSL ARELVEMHGG       600
     QVGLKSEVGM GSTFTFTIPD KPNTN                                             625
//

If you have problems or comments...

PBIL Back to PBIL home page