(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE281

CP001994.PE281       Location/Qualifiers
FT   CDS             309302..309685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0287"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="COGs: COG3355 transcriptional regulator protein;
FT                   InterPro IPR002831; PFAM: transcriptional regulator TrmB;
FT                   SPTR: Q12UA5 Transcriptional regulator TrmB; PFAM:
FT                   Sugar-specific transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35819"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G8"
FT                   /protein_id="ADE35819.1"
FT                   /translation="MTGSISEMLKANCECDDVAKCILGLKDLDLKAYKILLSNGPLTAE
FT                   KLGKYLDRERSTAYRSLQNLISCGLVYRETHTIDVGGYFYEYVAVNPAEVRRMLQESVD
FT                   QWYDKVSHLINKIDKELVGDEIP"
     MTGSISEMLK ANCECDDVAK CILGLKDLDL KAYKILLSNG PLTAEKLGKY LDRERSTAYR        60
     SLQNLISCGL VYRETHTIDV GGYFYEYVAV NPAEVRRMLQ ESVDQWYDKV SHLINKIDKE       120
     LVGDEIP                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page