(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE291

CP001994.PE291       Location/Qualifiers
FT   CDS             316901..317266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0297"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789; KEGG: pla:Plav_2814 response regulator
FT                   receiver protein; PFAM: response regulator receiver; SMART:
FT                   response regulator receiver; SPTR: Q12U95 Response
FT                   regulator receiver protein; PFAM: Response regulator
FT                   receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35829"
FT                   /db_xref="GOA:D5E9H8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H8"
FT                   /protein_id="ADE35829.1"
FT                   /translation="MATILVVEDNPMNMELTVDLLESYGYEVMQAEDGSQALDVVEKNT
FT                   FDLILLDMQLPKMDGLEVLEKFKEIENSKDTPVVALTAHAMRGDDKKFINAGCAGYISK
FT                   PIDIHEFQQTISSYVDN"
     MATILVVEDN PMNMELTVDL LESYGYEVMQ AEDGSQALDV VEKNTFDLIL LDMQLPKMDG        60
     LEVLEKFKEI ENSKDTPVVA LTAHAMRGDD KKFINAGCAG YISKPIDIHE FQQTISSYVD       120
     N                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page