(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE295

CP001994.PE295       Location/Qualifiers
FT   CDS             complement(319722..320204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0301"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1813 transcription factor homolog of
FT                   eukaryotic MBF1; InterPro IPR001387:IPR004451; KEGG:
FT                   hypothetical protein; K03627 putative transcription factor;
FT                   PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; SPTR: Q12U90
FT                   Transcriptional regulator, XRE family; PFAM:
FT                   Helix-turn-helix; TIGRFAM: conserved hypothetical protein
FT                   TIGR00270"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35833"
FT                   /db_xref="GOA:D5E9I2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004451"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I2"
FT                   /protein_id="ADE35833.1"
FT                   /translation="MQCEICGAEIKGEPFKINVEGSELNACNRCSQYGTSVSTRKPVSR
FT                   KNAPVRQGIKKSSKPKKNPVTAPTEELIDEYEQTIREAREEKGLTQEELASNIKEKASL
FT                   IKKIEKGDIVPEDSVRTKIEQALDIELTEKVGEDDWDTNTLNKGTTLGDIVTIKKK"
     MQCEICGAEI KGEPFKINVE GSELNACNRC SQYGTSVSTR KPVSRKNAPV RQGIKKSSKP        60
     KKNPVTAPTE ELIDEYEQTI REAREEKGLT QEELASNIKE KASLIKKIEK GDIVPEDSVR       120
     TKIEQALDIE LTEKVGEDDW DTNTLNKGTT LGDIVTIKKK                             160
//

If you have problems or comments...

PBIL Back to PBIL home page