(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE296

CP001994.PE296       Location/Qualifiers
FT   CDS             320290..321579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0302"
FT                   /product="Proteasome-activating nucleotidase"
FT                   /EC_number="3.6.1.3"
FT                   /note="COGs: COG1222 ATP-dependent 26S proteasome
FT                   regulatory subunit;
FT                   InterProIPR003959:IPR011704:IPR003593:IPR003960:IPR 005937;
FT                   KEGG: hypothetical protein; K03062 26S proteasome
FT                   regulatory subunit T2; PFAM: AAA ATPase central domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; PRIAM: Adenosinetriphosphatase; SMART: AAA ATPase;
FT                   SPTR: Q12U89 26S proteasome subunit P45 family; TIGRFAM:
FT                   26S proteasome subunit P45 family; PFAM: ATPase family
FT                   associated with various cellular activities (AAA); TIGRFAM:
FT                   26S proteasome subunit P45 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35834"
FT                   /db_xref="GOA:D5E9I3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR023501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I3"
FT                   /protein_id="ADE35834.1"
FT                   /translation="MNETSDDTLNQGNYGLKNMSDIEYDYMGSEGDEDFSKYLLDRMKQ
FT                   LESRNSKLKEQCDQIESEKKYVESQKVKYEREVRKLRSEINRLKTVPLIVANIIDVIDS
FT                   NKVLIRSSSGPQFMVGVSQYIDDSRLVAGVRVALNQQTLSIVDVLPSTEEPEVSAMEVL
FT                   ESQDISYEDIGGLDNQIQDIIECVELPLIKPESFERVGVEPPKGVLLHGPPGTGKTMMA
FT                   KAVAHRTDATFIRVVGSELVQKYIGEGSRLVREVFDMARKKAPSIIFIDELDAIAATRL
FT                   SDTNGADREVQRTLMQLLAEMDGFENRGDIRIIAATNRVDILDPAIIRPGRFDRMVEVP
FT                   MPDTESRSLILRIHSRGLSLALDVDFDKLATLTENTSGADLHALTTEAGMFAVRNDRDS
FT                   VTMADFMAAIDKVLKPRQPQVNEHPASMFV"
     MNETSDDTLN QGNYGLKNMS DIEYDYMGSE GDEDFSKYLL DRMKQLESRN SKLKEQCDQI        60
     ESEKKYVESQ KVKYEREVRK LRSEINRLKT VPLIVANIID VIDSNKVLIR SSSGPQFMVG       120
     VSQYIDDSRL VAGVRVALNQ QTLSIVDVLP STEEPEVSAM EVLESQDISY EDIGGLDNQI       180
     QDIIECVELP LIKPESFERV GVEPPKGVLL HGPPGTGKTM MAKAVAHRTD ATFIRVVGSE       240
     LVQKYIGEGS RLVREVFDMA RKKAPSIIFI DELDAIAATR LSDTNGADRE VQRTLMQLLA       300
     EMDGFENRGD IRIIAATNRV DILDPAIIRP GRFDRMVEVP MPDTESRSLI LRIHSRGLSL       360
     ALDVDFDKLA TLTENTSGAD LHALTTEAGM FAVRNDRDSV TMADFMAAID KVLKPRQPQV       420
     NEHPASMFV                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page