(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE301

CP001994.PE301       Location/Qualifiers
FT   CDS             complement(324206..325225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0307"
FT                   /product="translation initiation factor 2B subunit I family
FT                   (IF-2BI)"
FT                   /EC_number="5.3.1.23"
FT                   /note="COGs: COG0182 translation initiation factor 2B
FT                   subunit eIF-2B alpha/beta/delta family; InterPro
FT                   IPR000649:IPR011559:IPR005251; KEGG: gur:Gura_4322 aIF-2BI
FT                   family translation initiation factor; PFAM: initiation
FT                   factor 2B related; PRIAM: S-methyl-5-thioribose-1-phosphate
FT                   isomerase; SPTR: Q12U85 Translation initiation factor 2B
FT                   subunit I family (IF-2BI); TIGRFAM: translation initiation
FT                   factor, aIF-2BI family; eIF-2B alpha/beta/delta-related
FT                   uncharacterized protein; PFAM: Initiation factor 2 subunit
FT                   family; TIGRFAM: eIF-2B alpha/beta/delta-related
FT                   uncharacterized proteins; S-methyl-5-thioribose-1-phosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35839"
FT                   /db_xref="GOA:D5E9I8"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I8"
FT                   /protein_id="ADE35839.1"
FT                   /translation="MRTIQWNAENSTVRMIDQTLLPVEYREIECENLAQLCEAIKSLRV
FT                   RGAPALAAAGAYGIALASKLSSANDMESLLQDLKNATGIILATRPTAINLGWGVHRVIK
FT                   AVSEAYDTEGIRDIALNEAQAIADEDVQTNKTLGKHGASLLEDGDTVMTHCNAGRLACV
FT                   DWGTALGVVRSAVEQGKDINVVACETRPLNQGGRLTTWELMQDNIPVKLISDSMSGYVM
FT                   RHELVDKVIVGADRITEDAVFNKIGTYSHAIVAMEHEIPFYVAAPASTFDFKGWEDSVK
FT                   IEERDPDELRYMQGVQIAPEDVPVINPAFDSTPMEYIEAIITEKGIFRPPFLIDEVRT"
     MRTIQWNAEN STVRMIDQTL LPVEYREIEC ENLAQLCEAI KSLRVRGAPA LAAAGAYGIA        60
     LASKLSSAND MESLLQDLKN ATGIILATRP TAINLGWGVH RVIKAVSEAY DTEGIRDIAL       120
     NEAQAIADED VQTNKTLGKH GASLLEDGDT VMTHCNAGRL ACVDWGTALG VVRSAVEQGK       180
     DINVVACETR PLNQGGRLTT WELMQDNIPV KLISDSMSGY VMRHELVDKV IVGADRITED       240
     AVFNKIGTYS HAIVAMEHEI PFYVAAPAST FDFKGWEDSV KIEERDPDEL RYMQGVQIAP       300
     EDVPVINPAF DSTPMEYIEA IITEKGIFRP PFLIDEVRT                              339
//

If you have problems or comments...

PBIL Back to PBIL home page