(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE302

CP001994.PE302       Location/Qualifiers
FT   CDS             325311..327134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0308"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG1078 HD superfamily phosphohydrolase;
FT                   InterPro IPR006674:IPR003607; KEGG: geo:Geob_0579 metal
FT                   dependent phosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; SPTR: Q12U82 Metal-dependent
FT                   phosphohydrolase; PFAM: HD domain; TIGRFAM: uncharacterized
FT                   domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35840"
FT                   /db_xref="GOA:D5E9I9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I9"
FT                   /protein_id="ADE35840.1"
FT                   /translation="MVSSRAIHDPVHKTILLTPLQKELVETPQLQRLRSIQQLGLVDIV
FT                   YPGAKHSRFEHSLGTMHMASLMADALSLPQEDKVKVEVAGLLHDVGHSAYSHAVEDVLK
FT                   RNPDINPQYGGIIRENHEAFSEYVIRNCFAGNGNIARKVEEELGQDPVDFFDQIALMAT
FT                   GKSSFLEKPYLGQLISGDIDADRIDFLLRDSYHTGLSLGLIDVDQIIQNLSIRNGNIVL
FT                   GKKDGCSYDEDMTLTVAESMLIARTHHYNAIVHHPHTQSARIMLLRSLENALAMFGEKK
FT                   DAESVNDEVGLFFTEYNDADLLYFIKTYGNDQAQRLISSVLAGNICDPIVRFNQKNLNP
FT                   ATRMALSTIARHGVAKKMFEEQLEKRIGDVFVDLSVASGVPRSTRVVVNGEDSFFYDES
FT                   ALANGLVRAISRQLSLVVFSPVDGIGCPEAAQLKDVVGHTVETLSPQLLRFIRQENYLP
FT                   VEGLILLFYTVNSIFWKEEGGFVSIPRLRNITWIYRMVQRFSEDVRLRNLFDYNFHCNY
FT                   GFPYSNRVFEDIQLLVAMGIVDEDLRYYEKDNRFHQRYEYVLTMHGVKYGKQLSEAYSR
FT                   EFRELTKVLRQDKHSIPRDIVTIPARRYQQP"
     MVSSRAIHDP VHKTILLTPL QKELVETPQL QRLRSIQQLG LVDIVYPGAK HSRFEHSLGT        60
     MHMASLMADA LSLPQEDKVK VEVAGLLHDV GHSAYSHAVE DVLKRNPDIN PQYGGIIREN       120
     HEAFSEYVIR NCFAGNGNIA RKVEEELGQD PVDFFDQIAL MATGKSSFLE KPYLGQLISG       180
     DIDADRIDFL LRDSYHTGLS LGLIDVDQII QNLSIRNGNI VLGKKDGCSY DEDMTLTVAE       240
     SMLIARTHHY NAIVHHPHTQ SARIMLLRSL ENALAMFGEK KDAESVNDEV GLFFTEYNDA       300
     DLLYFIKTYG NDQAQRLISS VLAGNICDPI VRFNQKNLNP ATRMALSTIA RHGVAKKMFE       360
     EQLEKRIGDV FVDLSVASGV PRSTRVVVNG EDSFFYDESA LANGLVRAIS RQLSLVVFSP       420
     VDGIGCPEAA QLKDVVGHTV ETLSPQLLRF IRQENYLPVE GLILLFYTVN SIFWKEEGGF       480
     VSIPRLRNIT WIYRMVQRFS EDVRLRNLFD YNFHCNYGFP YSNRVFEDIQ LLVAMGIVDE       540
     DLRYYEKDNR FHQRYEYVLT MHGVKYGKQL SEAYSREFRE LTKVLRQDKH SIPRDIVTIP       600
     ARRYQQP                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page