(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE314

CP001994.PE314       Location/Qualifiers
FT   CDS             337441..338259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0320"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterPro IPR007197:IPR012840; KEGG: pca:Pcar_2732
FT                   pyruvate-formate lyase-activating enzyme; PFAM: Radical SAM
FT                   domain protein; SPTR: Q12U77 Ribonucleoside-triphosphate
FT                   reductase, anaerobic-like protein; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein;
FT                   PFAM: Radical SAM superfamily; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35852"
FT                   /db_xref="GOA:D5E9K1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K1"
FT                   /protein_id="ADE35852.1"
FT                   /translation="MAPRTCVKDFEVNFGDYVPLSTLDWPGKASVVFFLRDCPFRCPYC
FT                   QNYSILNGYELVESSQIRQLMETSRPFVSSVVISGGEPLQQEKAVSGIAQMARDMGLLV
FT                   GIHTNGVHTDVLEDLIENELVDGVFIDVKASLENAEDYGRMIGYGSYPAVTISPLDAVN
FT                   NVQRSIKMAAENKLLQELRTTVLPGFMDKPEDIESIASSIVKCAGRDIPYFIQQGETEH
FT                   SMDRNLRELSPLSRDELLSLGNAATPFLNNVCIRTGKNGTEKITSNQSVA"
     MAPRTCVKDF EVNFGDYVPL STLDWPGKAS VVFFLRDCPF RCPYCQNYSI LNGYELVESS        60
     QIRQLMETSR PFVSSVVISG GEPLQQEKAV SGIAQMARDM GLLVGIHTNG VHTDVLEDLI       120
     ENELVDGVFI DVKASLENAE DYGRMIGYGS YPAVTISPLD AVNNVQRSIK MAAENKLLQE       180
     LRTTVLPGFM DKPEDIESIA SSIVKCAGRD IPYFIQQGET EHSMDRNLRE LSPLSRDELL       240
     SLGNAATPFL NNVCIRTGKN GTEKITSNQS VA                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page