(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE315

CP001994.PE315       Location/Qualifiers
FT   CDS             338567..339451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0321"
FT                   /product="thiamine-phosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="COGs: COG0611 Thiamine monophosphate kinase;
FT                   InterPro IPR010918:IPR000728:IPR006283; KEGG: dal:Dalk_0686
FT                   thiamine-monophosphate kinase; PFAM: AIR synthase related
FT                   protein; AIR synthase related protein domain protein;
FT                   PRIAM: Thiamine-phosphate kinase; SPTR: Q12U75
FT                   Thiamine-monophosphate kinase; TIGRFAM:
FT                   thiamine-monophosphate kinase; PFAM: AIR synthase related
FT                   protein, N-terminal domain; AIR synthase related protein,
FT                   C-terminal domain; TIGRFAM: thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35853"
FT                   /db_xref="GOA:D5E9K2"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K2"
FT                   /protein_id="ADE35853.1"
FT                   /translation="MTAVLEFGGEYLVVTTDMLHQKTDFPDTMTPWQIGWMAAAVNFSD
FT                   IAAMGGQPLGLLAAVGYPQNMSLEDAGEIARGMRDCAEFCGTSVIGGDVDSHEELTVTG
FT                   TAMGRVSKEELLTRKGAKPGDLLCVTATLGGAGAALEAYLKNMNVDDDFMKPLLEPVPR
FT                   IAEGRKLAKSGAVTSAMDTSDGLALSLYDLASVNKVGFVLKEESLPIDKRVFEIATSKK
FT                   EALEMALYSGGDFELLVTVSKDKFKALQAESYLTVVGEVVDIDGAISLIGKDGANFAID
FT                   RKGYLHMGTSDQI"
     MTAVLEFGGE YLVVTTDMLH QKTDFPDTMT PWQIGWMAAA VNFSDIAAMG GQPLGLLAAV        60
     GYPQNMSLED AGEIARGMRD CAEFCGTSVI GGDVDSHEEL TVTGTAMGRV SKEELLTRKG       120
     AKPGDLLCVT ATLGGAGAAL EAYLKNMNVD DDFMKPLLEP VPRIAEGRKL AKSGAVTSAM       180
     DTSDGLALSL YDLASVNKVG FVLKEESLPI DKRVFEIATS KKEALEMALY SGGDFELLVT       240
     VSKDKFKALQ AESYLTVVGE VVDIDGAISL IGKDGANFAI DRKGYLHMGT SDQI             294
//

If you have problems or comments...

PBIL Back to PBIL home page