(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE316

CP001994.PE316       Location/Qualifiers
FT   CDS             339473..343273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0322"
FT                   /product="S-layer-related duplication domain protein"
FT                   /note="InterPro IPR006457:IPR003961; KEGG: pub:SAR11_0932
FT                   hypothetical protein; PFAM: S-layer-related duplication
FT                   domain; SMART: Fibronectin type III domain protein; SPTR:
FT                   Q12U74 S-layer-related duplication domain; PFAM: Protein of
FT                   unknown function (DUF1608); TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type; S-layer-related duplication domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35854"
FT                   /db_xref="GOA:D5E9K3"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006457"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K3"
FT                   /protein_id="ADE35854.1"
FT                   /translation="MKTGFKILLIGFMIIGMGCGVAAAESAPNASVTNVSSDVDSATID
FT                   FNVNQSDASTRIAYGISNSLSSWSDWNYEDSNSRSIVLSELNDGTMYYYSVYAYNGTND
FT                   SFVYNTTISTFNTDSPTAPNASVTNVSSDVDSATIDFNVNQSDASTRIAYGISNSLSSW
FT                   SDWNYEDSNSRSIVLSELNDRTMYYYSVYAYNGTNDSFVYNTTIATLNTTSPTAPNASV
FT                   TNVSSDVDSATIDFNVNQSDASTRIAYGISNSLSSWSDWNYEDSNSRSIVLSELNDGTM
FT                   YYYSVYAYNGTNDSFVYNTTIATLNTTSPTAPSISDISSSNIGGDRATINYVVNQSDAP
FT                   TRIAYGTSSDLSSYEWSGWFNDSTVHNETISNLNGSTKYYYSIYAYNESNNSVFYNSSI
FT                   ESFTTISNWGDRIWDEKANQSNKYTWDGRSFSGFYYDLDTGDTSESMTITIDGRRIDDG
FT                   DLVYTTKPIDKEFEFGSWGEYQIIGFMAERYFAGYSVNTSSDVTGDDVSLISDGVLSKV
FT                   LIDTDDDESVYSGSSLTLEEGYSLNIKQVDVNGDSVWISLTKDGDEVDDAILSSDETYV
FT                   YEKDLGGVDDVPVIAVHIDDVFSGTETNAVFIDGIFQISDDYVEVDRGDEFGEMEVTSL
FT                   SSTEIKMENEDSISLDEGDIIDIMGKLKFIVADDNDVLRFAPFVDMSEPGTYELRGTIA
FT                   EDEGFSWTPLNFEGFYYDIDEGLRSESLNVTNYNGRNIDAGDLIYKSTPVEVEFEYGPW
FT                   GKYNVIGFMAEKYFAGYSGDTSDDITDDTISLMSSGQLSKVLIDDDDEKSVYTGSSLIL
FT                   EEGYALNIREIDVNGDRVMIQLTQDGDNIESAIVSSDDEYVYEKDVGDEDDVPIIVVHF
FT                   NEIFSGTETSAVFVEGIFQISEDYLEVEDGDDFGVMTVDSTSGSIILENEDNIDLDEGD
FT                   TIDIMGEIKFKVADDSSTVRYYPFVEVETKPYDSLDIDIEPTTVVEGDEITFTVTSRGA
FT                   AIRDASILIHGDRVGITSDEGVFEYDADDAGKFTATAEKEGYVSSKGNFEVISPDDESK
FT                   KISIEVSPEEVFEGTPITISVVKAIGSEPLEGAEVFFDGKSLGETDEDGTITYNPKEPG
FT                   THKIEAKVDGYLDAELNIKVNELAANFEFSNLRIDPLPATAGEEFTVMLDSINTGNAEG
FT                   SYTVELSINDNVVDSQEITLGQNNSTTIEFTSTAGEPGTYLVKAGGLSTTMDVEEGTSI
FT                   VWYVLGGLVLVLGGGAAYIFATGGTAKFAEIAESLRSRLGR"
     MKTGFKILLI GFMIIGMGCG VAAAESAPNA SVTNVSSDVD SATIDFNVNQ SDASTRIAYG        60
     ISNSLSSWSD WNYEDSNSRS IVLSELNDGT MYYYSVYAYN GTNDSFVYNT TISTFNTDSP       120
     TAPNASVTNV SSDVDSATID FNVNQSDAST RIAYGISNSL SSWSDWNYED SNSRSIVLSE       180
     LNDRTMYYYS VYAYNGTNDS FVYNTTIATL NTTSPTAPNA SVTNVSSDVD SATIDFNVNQ       240
     SDASTRIAYG ISNSLSSWSD WNYEDSNSRS IVLSELNDGT MYYYSVYAYN GTNDSFVYNT       300
     TIATLNTTSP TAPSISDISS SNIGGDRATI NYVVNQSDAP TRIAYGTSSD LSSYEWSGWF       360
     NDSTVHNETI SNLNGSTKYY YSIYAYNESN NSVFYNSSIE SFTTISNWGD RIWDEKANQS       420
     NKYTWDGRSF SGFYYDLDTG DTSESMTITI DGRRIDDGDL VYTTKPIDKE FEFGSWGEYQ       480
     IIGFMAERYF AGYSVNTSSD VTGDDVSLIS DGVLSKVLID TDDDESVYSG SSLTLEEGYS       540
     LNIKQVDVNG DSVWISLTKD GDEVDDAILS SDETYVYEKD LGGVDDVPVI AVHIDDVFSG       600
     TETNAVFIDG IFQISDDYVE VDRGDEFGEM EVTSLSSTEI KMENEDSISL DEGDIIDIMG       660
     KLKFIVADDN DVLRFAPFVD MSEPGTYELR GTIAEDEGFS WTPLNFEGFY YDIDEGLRSE       720
     SLNVTNYNGR NIDAGDLIYK STPVEVEFEY GPWGKYNVIG FMAEKYFAGY SGDTSDDITD       780
     DTISLMSSGQ LSKVLIDDDD EKSVYTGSSL ILEEGYALNI REIDVNGDRV MIQLTQDGDN       840
     IESAIVSSDD EYVYEKDVGD EDDVPIIVVH FNEIFSGTET SAVFVEGIFQ ISEDYLEVED       900
     GDDFGVMTVD STSGSIILEN EDNIDLDEGD TIDIMGEIKF KVADDSSTVR YYPFVEVETK       960
     PYDSLDIDIE PTTVVEGDEI TFTVTSRGAA IRDASILIHG DRVGITSDEG VFEYDADDAG      1020
     KFTATAEKEG YVSSKGNFEV ISPDDESKKI SIEVSPEEVF EGTPITISVV KAIGSEPLEG      1080
     AEVFFDGKSL GETDEDGTIT YNPKEPGTHK IEAKVDGYLD AELNIKVNEL AANFEFSNLR      1140
     IDPLPATAGE EFTVMLDSIN TGNAEGSYTV ELSINDNVVD SQEITLGQNN STTIEFTSTA      1200
     GEPGTYLVKA GGLSTTMDVE EGTSIVWYVL GGLVLVLGGG AAYIFATGGT AKFAEIAESL      1260
     RSRLGR                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page