(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE318

CP001994.PE318       Location/Qualifiers
FT   CDS             344012..345022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0324"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="COGs: COG0715 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport systems periplasmic components; InterPro
FT                   IPR010067; KEGG: csa:Csal_0183 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport systems periplasmic
FT                   components-like protein; SPTR: Q8TUK2 Sulfonate ABC
FT                   transporter, solute-binding protein; TIGRFAM: aliphatic
FT                   sulfonates family ABC transporter, periplsmic
FT                   ligand-binding protein; PFAM: NMT1/THI5 like; TIGRFAM: ABC
FT                   transporter, substrate-binding protein, aliphatic
FT                   sulfonates family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35856"
FT                   /db_xref="GOA:D5E9K5"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K5"
FT                   /protein_id="ADE35856.1"
FT                   /translation="MKKISKILFLILVVAGSVFLAGCASQDGDGTEEAADVTTLNIGYQ
FT                   PSTHQLSYMTAREKGWWEEDLASYGVEEVKEYEFPTGAPEMQAMLAGDLDVAYVGAAPF
FT                   ISALSNGLDAKVVAGVNSQGSDLVLRPEHSYEGPEDLKGLSIATFPPGTIQDTILRDWL
FT                   KDNGVDPDDDVDIKPMGPGDAISAISAGQIDAAFLPHPAPTLIEQEGNGRSVVYSGEML
FT                   PDHACCVLVVSGNLIRNHPEMVTEIVNTHIKATDYNLENQDEAAQIFAERQGWEVNVVR
FT                   TSIDEWDGQWIADPAIIADSTVDYAQVQYELGYVNEKFTREDIFDMSFYELAITE"
     MKKISKILFL ILVVAGSVFL AGCASQDGDG TEEAADVTTL NIGYQPSTHQ LSYMTAREKG        60
     WWEEDLASYG VEEVKEYEFP TGAPEMQAML AGDLDVAYVG AAPFISALSN GLDAKVVAGV       120
     NSQGSDLVLR PEHSYEGPED LKGLSIATFP PGTIQDTILR DWLKDNGVDP DDDVDIKPMG       180
     PGDAISAISA GQIDAAFLPH PAPTLIEQEG NGRSVVYSGE MLPDHACCVL VVSGNLIRNH       240
     PEMVTEIVNT HIKATDYNLE NQDEAAQIFA ERQGWEVNVV RTSIDEWDGQ WIADPAIIAD       300
     STVDYAQVQY ELGYVNEKFT REDIFDMSFY ELAITE                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page