(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE319

CP001994.PE319       Location/Qualifiers
FT   CDS             345107..345886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0325"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0600 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system permease component; InterPro IPR000515;
FT                   KEGG: dal:Dalk_1379 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Q12U71 ABC nitrate/sulfonate/bicarbonate
FT                   transporter, inner membrane subunit; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35857"
FT                   /db_xref="GOA:D5E9K6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K6"
FT                   /protein_id="ADE35857.1"
FT                   /translation="MKTKPVSKKGIEIISLVTAIILWQLLADLVIGNTFILPSFTDVVY
FT                   AFITIIERGVLFTDLTISLLHFGIGIISALVIGVPIGIAMGWFHNADRVADPLIEIVRP
FT                   IPPLAWIPFAIVWFGLTHISAGFVVFVGAVFPIIINTLTGFKSVSKVYVEAGKVLGCMK
FT                   STSLIRYIALPYSLPSIAAGIRIAMGVGWMCLVAAEMFGVSKNGLGYKIWWHYYLHQMD
FT                   FVLVYMLILGFLGLLIDRVFRWYVDGKLLKWRKGVVV"
     MKTKPVSKKG IEIISLVTAI ILWQLLADLV IGNTFILPSF TDVVYAFITI IERGVLFTDL        60
     TISLLHFGIG IISALVIGVP IGIAMGWFHN ADRVADPLIE IVRPIPPLAW IPFAIVWFGL       120
     THISAGFVVF VGAVFPIIIN TLTGFKSVSK VYVEAGKVLG CMKSTSLIRY IALPYSLPSI       180
     AAGIRIAMGV GWMCLVAAEM FGVSKNGLGY KIWWHYYLHQ MDFVLVYMLI LGFLGLLIDR       240
     VFRWYVDGKL LKWRKGVVV                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page