(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE323

CP001994.PE323       Location/Qualifiers
FT   CDS             complement(347836..348534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0329"
FT                   /product="protein of unknown function DUF169"
FT                   /note="COGs: COG2043 conserved hypothetical protein;
FT                   InterPro IPR003748; KEGG: glo:Glov_0919 protein of unknown
FT                   function DUF169; PFAM: protein of unknown function DUF169;
FT                   SPTR: Q8PY80 Conserved protein; PFAM: Uncharacterised ArCR,
FT                   COG2043"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35861"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L0"
FT                   /protein_id="ADE35861.1"
FT                   /translation="MENKEISDKLKEILQLRYEPVAVKLVKRGEDVPANFNQPEKKTRH
FT                   CQSIMKARKGECLVIPADKHACVVGGSSLGLLETPDNVKSGEFHSKIGMFDTPQAAAKM
FT                   IEERAEFEECSMQATVVCPLAKADFKPDVVILIDLPETLYWIVPAFTFETGGRVTMSTA
FT                   PFQATCVDSTIIPIQTGDINYSMGCFGCRRTTDIGRDEMLVGIPGPILENIVEHLEELY
FT                   KKPIKKARGL"
     MENKEISDKL KEILQLRYEP VAVKLVKRGE DVPANFNQPE KKTRHCQSIM KARKGECLVI        60
     PADKHACVVG GSSLGLLETP DNVKSGEFHS KIGMFDTPQA AAKMIEERAE FEECSMQATV       120
     VCPLAKADFK PDVVILIDLP ETLYWIVPAF TFETGGRVTM STAPFQATCV DSTIIPIQTG       180
     DINYSMGCFG CRRTTDIGRD EMLVGIPGPI LENIVEHLEE LYKKPIKKAR GL               232
//

If you have problems or comments...

PBIL Back to PBIL home page