(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE324

CP001994.PE324       Location/Qualifiers
FT   CDS             complement(348569..349402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0330"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR019591:IPR002586:IPR000808; KEGG:
FT                   sat:SYN_00081 iron-sulfur cluster assembly/repair protein;
FT                   PFAM: ATPase-like, ParA/MinD; Cobyrinic acid ac-diamide
FT                   synthase; SPTR: Q12U65 ATP-binding protein involved in
FT                   chromosome partitioning; PFAM: ParA/MinD ATPase like;
FT                   Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35862"
FT                   /db_xref="GOA:D5E9L1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L1"
FT                   /protein_id="ADE35862.1"
FT                   /translation="MSQNIQSAESLVNSKVEEPKIVSNLRGIRNKLMVMSGKGGVGKST
FT                   VSANLAAALARRGKKVGLLDSDIHGPSIPTMFGIADQRPEVGEKGILPVQVADNLKVMS
FT                   IGLLLDDPDSPVVWRGPAKMGAIKQFLEEVDWGVLDYLIIDLPPGTGDEPLSIVQLLGR
FT                   VDGAIVVTTPQDVALTSVRKSLKFAEMLEVPVIGMVENMSGVICPHCNEEIQVFGGESV
FT                   EKAAKDFNTPILATLPIEPDVSSTGDKGDVYVNDDKSIWKEKFDSIVSSVEEKFN"
     MSQNIQSAES LVNSKVEEPK IVSNLRGIRN KLMVMSGKGG VGKSTVSANL AAALARRGKK        60
     VGLLDSDIHG PSIPTMFGIA DQRPEVGEKG ILPVQVADNL KVMSIGLLLD DPDSPVVWRG       120
     PAKMGAIKQF LEEVDWGVLD YLIIDLPPGT GDEPLSIVQL LGRVDGAIVV TTPQDVALTS       180
     VRKSLKFAEM LEVPVIGMVE NMSGVICPHC NEEIQVFGGE SVEKAAKDFN TPILATLPIE       240
     PDVSSTGDKG DVYVNDDKSI WKEKFDSIVS SVEEKFN                                277
//

If you have problems or comments...

PBIL Back to PBIL home page