(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE326

CP001994.PE326       Location/Qualifiers
FT   CDS             349835..350950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0332"
FT                   /product="ORC complex protein Cdc6/Orc1"
FT                   /note="COGs: COG1474 Cdc6-related protein AAA superfamily
FT                   ATPase; InterPro IPR003593:IPR014277; KEGG: similar to
FT                   AGAP005176-PA; K02213 cell division control protein 6;
FT                   SMART: AAA ATPase; SPTR: Q12U63 ORC complex protein
FT                   Cdc6/Orc1; TIGRFAM: orc1/cdc6 family replication initiation
FT                   protein; PFAM: ATPase family associated with various
FT                   cellular activities (AAA); CDC6, C terminal; TIGRFAM:
FT                   orc1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35864"
FT                   /db_xref="GOA:D5E9L3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L3"
FT                   /protein_id="ADE35864.1"
FT                   /translation="MKNNMLLWDETIFRDPTVLELDYLPEQFMHRDSQLQSLIYSLKPA
FT                   VKGMRPINCLVYGPPGTGKTSAVLKVFEEIETHTSDVVLVKINCQMDSTRFAVVSRIYR
FT                   KLFNIDPPSSGVAFRKLFEKIVLKLIEKDKVMVVCLDDINYLFHGGHADEIMYSILRAH
FT                   EQYPGVKMGVIAIVSDTGKLYRFDPKVSSVFLPEEIEFPSYSYDEVGDIISSRIQLAFY
FT                   PEVVPEEVREKIVNYVDLTGDLRVGIDLLKRSGLNAEKRASKNISEDDVDKAYESSRLL
FT                   HLRRNISSLSDNEKEILRLVAENDEIKAGELYELFTGNNELGYTRFYGLVNKLKDSHYL
FT                   DVSFSGEGMRGRTRIIRLNYPADDVIKCIRG"
     MKNNMLLWDE TIFRDPTVLE LDYLPEQFMH RDSQLQSLIY SLKPAVKGMR PINCLVYGPP        60
     GTGKTSAVLK VFEEIETHTS DVVLVKINCQ MDSTRFAVVS RIYRKLFNID PPSSGVAFRK       120
     LFEKIVLKLI EKDKVMVVCL DDINYLFHGG HADEIMYSIL RAHEQYPGVK MGVIAIVSDT       180
     GKLYRFDPKV SSVFLPEEIE FPSYSYDEVG DIISSRIQLA FYPEVVPEEV REKIVNYVDL       240
     TGDLRVGIDL LKRSGLNAEK RASKNISEDD VDKAYESSRL LHLRRNISSL SDNEKEILRL       300
     VAENDEIKAG ELYELFTGNN ELGYTRFYGL VNKLKDSHYL DVSFSGEGMR GRTRIIRLNY       360
     PADDVIKCIR G                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page