(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE327

CP001994.PE327       Location/Qualifiers
FT   CDS             351000..351500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0333"
FT                   /product="putative transcriptional regulator, ModE family"
FT                   /note="COGs: COG2005 N-terminal domain of
FT                   molybdenum-binding protein; InterPro IPR000847:IPR005116;
FT                   KEGG: tdn:Suden_1537 ModE family transcriptional regulator;
FT                   PFAM: regulatory protein LysR; TOBE domain protein; SPTR:
FT                   Q12U62 Molybdenum-pterin binding domain; PFAM: TOBE domain;
FT                   Bacterial regulatory helix-turn-helix protein, lysR family;
FT                   TIGRFAM: ModE molybdate transport repressor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35865"
FT                   /db_xref="GOA:D5E9L4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L4"
FT                   /protein_id="ADE35865.1"
FT                   /translation="MIGAGKVRLLKVIDEEKSLKKACEKLDISYKHAWNILKKMNLRIG
FT                   HDVVRTVRGGKEQGTFLTEYGRDLINQYEMNRDYVDRMVEEELSSENMGETNNIPGKVR
FT                   KVESSDGISRTQIEVESAVLTSIMGEKELGNLHLDEGDEVIATIRAVDIDVSPAKYTKY
FT                   GGE"
     MIGAGKVRLL KVIDEEKSLK KACEKLDISY KHAWNILKKM NLRIGHDVVR TVRGGKEQGT        60
     FLTEYGRDLI NQYEMNRDYV DRMVEEELSS ENMGETNNIP GKVRKVESSD GISRTQIEVE       120
     SAVLTSIMGE KELGNLHLDE GDEVIATIRA VDIDVSPAKY TKYGGE                      166
//

If you have problems or comments...

PBIL Back to PBIL home page