(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE329

CP001994.PE329       Location/Qualifiers
FT   CDS             complement(352318..354003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0335"
FT                   /product="thermosome subunit"
FT                   /note="COGs: COG0459 Chaperonin GroEL (HSP60 family);
FT                   InterProIPR017998:IPR001844:IPR002423:IPR002194:IPR 012714;
FT                   KEGG: hypothetical protein; K09496 T-complex protein 1
FT                   subunit delta; PFAM: chaperonin Cpn60/TCP-1; SPTR: Q12U60
FT                   Thermosome, Chaperonin Cpn60/TCP-1; TIGRFAM: thermosome;
FT                   PFAM: TCP-1/cpn60 chaperonin family; TIGRFAM: thermosome,
FT                   various subunits, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35867"
FT                   /db_xref="GOA:D5E9L6"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L6"
FT                   /protein_id="ADE35867.1"
FT                   /translation="MAGQMSGGQPIFILRDGNQRTRGRDAQSNNIMAAKAVAEAVRTTL
FT                   GPKGMDKMLVDSLGDVVITNDGATILKEMDIEHPAAKMIVEVSKTQDDEVGDGTTTAAV
FT                   ITGELLKKAEDMIEQDVHPTIIASGYRMAAEKAGELLKELAQDVTIDNRDTLINISNTA
FT                   MTGKGAEASKDVLSEIAVSAVASIVDKTDGETIDIDNIKVEKKVGGSIEDSELIEGMIL
FT                   DKERVHSNMPKKVTDAKIALINSAIELKETEVDAEISITSPDQLQSFLDQEEKMLKGLV
FT                   DKVVASGANVVFCQKGIDDMAQHFLAKEGIFAVRRVKKSDMEKLVRSTGGKLITNIEEM
FT                   TADDLGKTEAVEERKIAGDNMVFITGCVNPRSVSILLRGGTEHVVDNIERALHDALRVV
FT                   GVAIEDEKLVSGGGGPEVEVALQLQDYASSLSGREQLAVKAFAESLEVIPRTLAENAGL
FT                   DPIDMLVELRSHHEKGAKTAGLDVYSGKVIDMWDAGVVEPLRIKTQAINAAAEASVMIL
FT                   RIDDVIASSNPSPSGGGGEGGMPPGMGGGMPPGMGGMPPGMGGM"
     MAGQMSGGQP IFILRDGNQR TRGRDAQSNN IMAAKAVAEA VRTTLGPKGM DKMLVDSLGD        60
     VVITNDGATI LKEMDIEHPA AKMIVEVSKT QDDEVGDGTT TAAVITGELL KKAEDMIEQD       120
     VHPTIIASGY RMAAEKAGEL LKELAQDVTI DNRDTLINIS NTAMTGKGAE ASKDVLSEIA       180
     VSAVASIVDK TDGETIDIDN IKVEKKVGGS IEDSELIEGM ILDKERVHSN MPKKVTDAKI       240
     ALINSAIELK ETEVDAEISI TSPDQLQSFL DQEEKMLKGL VDKVVASGAN VVFCQKGIDD       300
     MAQHFLAKEG IFAVRRVKKS DMEKLVRSTG GKLITNIEEM TADDLGKTEA VEERKIAGDN       360
     MVFITGCVNP RSVSILLRGG TEHVVDNIER ALHDALRVVG VAIEDEKLVS GGGGPEVEVA       420
     LQLQDYASSL SGREQLAVKA FAESLEVIPR TLAENAGLDP IDMLVELRSH HEKGAKTAGL       480
     DVYSGKVIDM WDAGVVEPLR IKTQAINAAA EASVMILRID DVIASSNPSP SGGGGEGGMP       540
     PGMGGGMPPG MGGMPPGMGG M                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page