(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE331

CP001994.PE331       Location/Qualifiers
FT   CDS             complement(354453..355349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0337"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG2113 ABC-type proline/glycine betaine
FT                   transport systems periplasmic components; InterPro
FT                   IPR007210; KEGG: aeh:Mlg_0734 response regulator receiver
FT                   protein; PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; SPTR: Q8TNY0 Glycine
FT                   betaine/L-proline ABC transporter, solute-binding protein;
FT                   PFAM: Substrate binding domain of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35869"
FT                   /db_xref="GOA:D5E9L8"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L8"
FT                   /protein_id="ADE35869.1"
FT                   /translation="MKYKLLKILACLIVAIALIGAGCTSQSDETPSEETTEEPVRIGVV
FT                   QWDDSRATGNVFLHILDEGGYEYETVSADLGGLYQATSQGDIDVLIQAWLPATQASYWD
FT                   QYGDSLNKAQVVSSGAKIGLAVPDYVYDSGITTVEDLKGNASKFDGKITGIEPGAGIMV
FT                   TTEQALEEYNLEEYELYSSSTVGMATTLQDNLDNEEWIVATLWRPHWTFARMEGLQFLE
FT                   DPKGIYGGSDNLVILTRPGFEEDRPEFYQLIQNYEMDLNDIESIMIAIDEGQSPEEAAS
FT                   DWLTENPEKYDEVLGTQ"
     MKYKLLKILA CLIVAIALIG AGCTSQSDET PSEETTEEPV RIGVVQWDDS RATGNVFLHI        60
     LDEGGYEYET VSADLGGLYQ ATSQGDIDVL IQAWLPATQA SYWDQYGDSL NKAQVVSSGA       120
     KIGLAVPDYV YDSGITTVED LKGNASKFDG KITGIEPGAG IMVTTEQALE EYNLEEYELY       180
     SSSTVGMATT LQDNLDNEEW IVATLWRPHW TFARMEGLQF LEDPKGIYGG SDNLVILTRP       240
     GFEEDRPEFY QLIQNYEMDL NDIESIMIAI DEGQSPEEAA SDWLTENPEK YDEVLGTQ         298
//

If you have problems or comments...

PBIL Back to PBIL home page