(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE334

CP001994.PE334       Location/Qualifiers
FT   CDS             complement(357196..358344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0340"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /EC_number="3.6.3.32"
FT                   /note="COGs: COG4175 ABC-type proline/glycine betaine
FT                   transport system ATPase component;
FT                   InterProIPR000644:IPR003439:IPR003593:IPR017871:IPR 005892;
FT                   KEGG: mxa:MXAN_2249 glycine betaine/L-proline ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; CBS domain containing protein; SMART: AAA ATPase;
FT                   CBS domain containing protein; SPTR: Q2KP07 ATP-binding
FT                   protein; TIGRFAM: glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter; CBS
FT                   domain; TIGRFAM: glycine betaine/L-proline transport ATP
FT                   binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35872"
FT                   /db_xref="GOA:D5E9M1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M1"
FT                   /protein_id="ADE35872.1"
FT                   /translation="MSYVEEGLSKDEIFNKTGQTVGLYNVSFDVYEGEIFVLMGLSGSG
FT                   KSTLLRCLNRLIEPTSGSITISDEDVTKASSERLRLIREKQISMVFQNFALLPHRTIID
FT                   NVAYGLEIQDFSKDERHEKAAVAIETVGLKGHEFSKPSQLSGGMQQRVGLARALATDPE
FT                   ILLMDEAFSALDPLIRSEMQDELLELEEKMQKTIVFVSHDLDEALKLGDRIALMKDGEI
FT                   AQIGTAEEILTNPANDYVSKFVAGVDKTKILTAENIMKRPDPVVSFKSGLQVALKLMEK
FT                   HGISSIYVVDKAKRLQGFLKADDAVRAQKAGKTMEDVIIKEFPKTTLDTPLQDLISIRA
FT                   ETDQPIAIVNENDKLVGVVVRGSILAALKTTEDEEQVEEAEQ"
     MSYVEEGLSK DEIFNKTGQT VGLYNVSFDV YEGEIFVLMG LSGSGKSTLL RCLNRLIEPT        60
     SGSITISDED VTKASSERLR LIREKQISMV FQNFALLPHR TIIDNVAYGL EIQDFSKDER       120
     HEKAAVAIET VGLKGHEFSK PSQLSGGMQQ RVGLARALAT DPEILLMDEA FSALDPLIRS       180
     EMQDELLELE EKMQKTIVFV SHDLDEALKL GDRIALMKDG EIAQIGTAEE ILTNPANDYV       240
     SKFVAGVDKT KILTAENIMK RPDPVVSFKS GLQVALKLME KHGISSIYVV DKAKRLQGFL       300
     KADDAVRAQK AGKTMEDVII KEFPKTTLDT PLQDLISIRA ETDQPIAIVN ENDKLVGVVV       360
     RGSILAALKT TEDEEQVEEA EQ                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page