(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE336

CP001994.PE336       Location/Qualifiers
FT   CDS             359902..361692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0342"
FT                   /product="protein of unknown function DUF87"
FT                   /note="COGs: COG0433 ATPase; InterPro IPR002789; KEGG:
FT                   pfs:PFLU0171 hypothetical protein; PFAM: protein of unknown
FT                   function DUF87; SPTR: Q12U57 ATPase; PFAM: Domain of
FT                   unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35874"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M3"
FT                   /protein_id="ADE35874.1"
FT                   /translation="MDNDDDILAYATGTKGGSVSSREPVEDFEEYVPDTVDNPDESFFD
FT                   DALGTITTGIDPLEITEAGARLTGYITASHRPNVRLGTYVLVPYGDEDLFARVWKLQYL
FT                   QEFEVDDATELHSRRMLKANNTNEIDYKFLAYLDPLCILSPAKAGLMRRMADRLPRPNT
FT                   PILPVSEKLKIQTGLNIPTEGIFLGHLSVGGELVRTHASPPTVAYYLRNDYSMGDPLMF
FT                   RHMLVCGSTGTGKTFLTKNILRQFLASDNQYLVRGEQGRKKNPCLVIMDPQDEYSQLFE
FT                   DNAEIGYADEVTFAEEDVLHGGHQDTRTFLASVDGQSYPGKSRAQQMEFTIPFELVRNN
FT                   SWLISAAELTENQYIGLELLLEDYFRTPANHTYQGFTDFIADEGTRSVYVDSGKIHESS
FT                   YDAIVRKVKNRSFSKVFDQPAKPITEILDEVFKPGRVSVFPTEYINNSRIRDLITLTLM
FT                   TIVVDNKLSTSGNDSVKKTPVLLALDEAHRYLSGAMSAHSRRIVSRFADAARQGRKETL
FT                   GLFLITQDPQDIDDTVLKQINSRIILNLSNDNAINALNVPLEFEKRIPYLRKGQMIIQS
FT                   PDNSDIVEVTGLHKCVVKHA"
     MDNDDDILAY ATGTKGGSVS SREPVEDFEE YVPDTVDNPD ESFFDDALGT ITTGIDPLEI        60
     TEAGARLTGY ITASHRPNVR LGTYVLVPYG DEDLFARVWK LQYLQEFEVD DATELHSRRM       120
     LKANNTNEID YKFLAYLDPL CILSPAKAGL MRRMADRLPR PNTPILPVSE KLKIQTGLNI       180
     PTEGIFLGHL SVGGELVRTH ASPPTVAYYL RNDYSMGDPL MFRHMLVCGS TGTGKTFLTK       240
     NILRQFLASD NQYLVRGEQG RKKNPCLVIM DPQDEYSQLF EDNAEIGYAD EVTFAEEDVL       300
     HGGHQDTRTF LASVDGQSYP GKSRAQQMEF TIPFELVRNN SWLISAAELT ENQYIGLELL       360
     LEDYFRTPAN HTYQGFTDFI ADEGTRSVYV DSGKIHESSY DAIVRKVKNR SFSKVFDQPA       420
     KPITEILDEV FKPGRVSVFP TEYINNSRIR DLITLTLMTI VVDNKLSTSG NDSVKKTPVL       480
     LALDEAHRYL SGAMSAHSRR IVSRFADAAR QGRKETLGLF LITQDPQDID DTVLKQINSR       540
     IILNLSNDNA INALNVPLEF EKRIPYLRKG QMIIQSPDNS DIVEVTGLHK CVVKHA           596
//

If you have problems or comments...

PBIL Back to PBIL home page