(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE338

CP001994.PE338       Location/Qualifiers
FT   CDS             363165..363428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_0322 hypothetical protein; SPTR:
FT                   Q12TX4 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3303)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35876"
FT                   /db_xref="InterPro:IPR021734"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M5"
FT                   /protein_id="ADE35876.1"
FT                   /translation="MLYMDVSTWEPTLSDKVIEHFKELKPPAGINIIKQWVDLTGGRYF
FT                   ILYECDDAEAYAAFNLPWSDICEIDSVPVMESTDFIKLMSKQ"
     MLYMDVSTWE PTLSDKVIEH FKELKPPAGI NIIKQWVDLT GGRYFILYEC DDAEAYAAFN        60
     LPWSDICEID SVPVMESTDF IKLMSKQ                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page