(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE340

CP001994.PE340       Location/Qualifiers
FT   CDS             364179..364349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0346"
FT                   /product="putative transcriptional regulator, CopG/Arc/MetJ
FT                   family"
FT                   /note="SPTR: Q8TUL1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35878"
FT                   /db_xref="GOA:D5E9M7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M7"
FT                   /protein_id="ADE35878.1"
FT                   /translation="MPKVSVDIPQQLLDDLNCHVGENRKFVSQSDAIRTAIRKLLDRMD
FT                   DVDTRHGRVKE"
     MPKVSVDIPQ QLLDDLNCHV GENRKFVSQS DAIRTAIRKL LDRMDDVDTR HGRVKE            56
//

If you have problems or comments...

PBIL Back to PBIL home page