(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE342

CP001994.PE342       Location/Qualifiers
FT   CDS             complement(365120..365554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0348"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="COGs: COG1931 conserved hypothetical protein;
FT                   InterPro IPR002739; PFAM: Protein of unknown function
FT                   DUF54; SPTR: Q12U54 Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF54"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35880"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M9"
FT                   /protein_id="ADE35880.1"
FT                   /translation="MASVKLWACVNPTEDASKVCEGLTRISGLAPRLDDNIAVIDCNHR
FT                   DLQIFHHLLRDEEILDTARSVLEKGIHSPEEKISFMLNKQVAFVGRISFPAGEEELGSI
FT                   HVEIQCNGGELEDIINWLAPPTEEGKPVYEKDMPPLREGE"
     MASVKLWACV NPTEDASKVC EGLTRISGLA PRLDDNIAVI DCNHRDLQIF HHLLRDEEIL        60
     DTARSVLEKG IHSPEEKISF MLNKQVAFVG RISFPAGEEE LGSIHVEIQC NGGELEDIIN       120
     WLAPPTEEGK PVYEKDMPPL REGE                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page