(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE345

CP001994.PE345       Location/Qualifiers
FT   CDS             367311..367856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0351"
FT                   /product="pyruvate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG1014 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase gamma subunit;
FT                   InterPro IPR019752:IPR011894; KEGG: lch:Lcho_2149
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate/ketoisovalerate oxidoreductase; SPTR: Q12U51
FT                   Pyruvate ferredoxin oxidoreductase, gamma subunit; TIGRFAM:
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   TIGRFAM: 2-oxoacid:acceptor oxidoreductase, gamma subunit,
FT                   pyruvate/2-ketoisovalerate family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35883"
FT                   /db_xref="GOA:D5E9N2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N2"
FT                   /protein_id="ADE35883.1"
FT                   /translation="MKEIRIHGRGGQGSVTAAELLAGAAFEDSQFSQAFPAFGVERRGA
FT                   PVQAFTRISDAPIRLRSQIYEPDYVIVQDPTLIEVVDVESGAKDDGIILINSDFAPEDF
FT                   DLDTNARIMTVNATKVALDIIGRPIVNTVLLGAFAGATGEVRASSIVNAVKGRFSGKIG
FT                   EKNAEAVQKAYDLMAEEK"
     MKEIRIHGRG GQGSVTAAEL LAGAAFEDSQ FSQAFPAFGV ERRGAPVQAF TRISDAPIRL        60
     RSQIYEPDYV IVQDPTLIEV VDVESGAKDD GIILINSDFA PEDFDLDTNA RIMTVNATKV       120
     ALDIIGRPIV NTVLLGAFAG ATGEVRASSI VNAVKGRFSG KIGEKNAEAV QKAYDLMAEE       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page