(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE350

CP001994.PE350       Location/Qualifiers
FT   CDS             370978..372069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0356"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0389 Nucleotidyltransferase/DNA polymerase
FT                   involved in DNA repair; InterPro IPR001126:IPR017963; KEGG:
FT                   sat:SYN_02012 DNA polymerase IV; PFAM: UMUC domain protein
FT                   DNA-repair protein; PRIAM: DNA-directed DNA polymerase;
FT                   SPTR: Q8TIW3 DNA polymerase IV; PFAM: impB/mucB/samB family
FT                   C-terminal; impB/mucB/samB family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35888"
FT                   /db_xref="GOA:D5E9N7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N7"
FT                   /protein_id="ADE35888.1"
FT                   /translation="MSRIVVHVDMDYFYAAVEEREDPSLRGRSVVVCMYSGRGEHRGSV
FT                   STSNYTARKYGIKSGMPCSRAIKLNQDAVFLPVRKEFYTEVSDSIMEVLRSHADSDESF
FT                   EQISIDEAFIEVTANCNDDFECALKLGEDIKQKILEKEQLTCSVGIGPNKLIAKMASSE
FT                   NKPNGITVISQHDVKPFLEDRTPSQLWGVGDVTAGRLEQMGIKKVGQLASSDIVSLTDA
FT                   FGKKKGSWLKKAAQGMDESPVRQREGSEQIGRIATLPENSSEYDLIMPVLDNLADDVIR
FT                   KTIERGVSFRQVTLIVITSDFKTQTRNHTLQRAVAEKEILRSNLDKLLTTFLEENKSAI
FT                   RRIGVRVAGLQEVSSQTTLASYF"
     MSRIVVHVDM DYFYAAVEER EDPSLRGRSV VVCMYSGRGE HRGSVSTSNY TARKYGIKSG        60
     MPCSRAIKLN QDAVFLPVRK EFYTEVSDSI MEVLRSHADS DESFEQISID EAFIEVTANC       120
     NDDFECALKL GEDIKQKILE KEQLTCSVGI GPNKLIAKMA SSENKPNGIT VISQHDVKPF       180
     LEDRTPSQLW GVGDVTAGRL EQMGIKKVGQ LASSDIVSLT DAFGKKKGSW LKKAAQGMDE       240
     SPVRQREGSE QIGRIATLPE NSSEYDLIMP VLDNLADDVI RKTIERGVSF RQVTLIVITS       300
     DFKTQTRNHT LQRAVAEKEI LRSNLDKLLT TFLEENKSAI RRIGVRVAGL QEVSSQTTLA       360
     SYF                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page